DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and AT2G23200

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_179901.1 Gene:AT2G23200 / 816852 AraportID:AT2G23200 Length:834 Species:Arabidopsis thaliana


Alignment Length:355 Identity:105/355 - (29%)
Similarity:169/355 - (47%) Gaps:60/355 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 PFPSSSGVSNSNNNRTSTTATEEIPSLESLGNIHISTVQRAAESLLEIDYAELENATDGWSPDNR 218
            |.|...|  .|::||..:....     ..|.|:|:.         |.|.:.::.:||:.:.....
plant   445 PLPLHRG--GSSDNRPISQYHN-----SPLRNLHLG---------LTIPFTDILSATNNFDEQLL 493

  Fly   219 LGQGGFGDVY-------------RGKWKQLDVAIKVMNYRSPNIDQKMVELQQSYNELKYLNSIR 270
            :|:||||.||             |||               ....|.::|.|   .|::.|:.||
plant   494 IGKGGFGYVYKAILPDGTKAAIKRGK---------------TGSGQGILEFQ---TEIQVLSRIR 540

  Fly   271 HDNILALYGYSIKGGKPCLVYQLMKGGSLEARLRAHKAQNPLPALTWQQRFSISLGTARGIYFLH 335
            |.::::|.||..:..:..|||:.|:.|:    |:.|...:.||:|||:||..|.:|.|||:.:||
plant   541 HRHLVSLTGYCEENSEMILVYEFMEKGT----LKEHLYGSNLPSLTWKQRLEICIGAARGLDYLH 601

  Fly   336 TARGT-PLIHGDIKPANILLDQCLQPKIGDFGLVREGPKSLDAVVEVNKVFGTKIYLPPEFRNFR 399
            ::... .:||.|:|..|||||:....|:.||||.:...:. ::.:.:| :.||..||.||:....
plant   602 SSGSEGAIIHRDVKSTNILLDEHNIAKVADFGLSKIHNQD-ESNISIN-IKGTFGYLDPEYLQTH 664

  Fly   400 QLSTGVDVYSFGIVLLEVFTGRQVTD-RVPENETKKNLLDYVKQQWRQNRM-ELLEKHLAAPMGK 462
            :|:...|||:||:|||||...|...| .:|..|.  ||.::|.....:..: |:|:..|...:  
plant   665 KLTEKSDVYAFGVVLLEVLFARPAIDPYLPHEEV--NLSEWVMFCKSKGTIDEILDPSLIGQI-- 725

  Fly   463 ELDMCMCAIEAGLHCTALDPQDRPSMNAVL 492
            |.:.....:|....|......:||||..|:
plant   726 ETNSLKKFMEIAEKCLKEYGDERPSMRDVI 755

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 92/290 (32%)
TyrKc 219..495 CDD:197581 92/290 (32%)
AT2G23200NP_179901.1 Malectin_like 41..383 CDD:289580
STKc_IRAK 494..759 CDD:270968 92/290 (32%)
TyrKc 494..758 CDD:197581 92/290 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.