DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and SRF1

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_565489.2 Gene:SRF1 / 816618 AraportID:AT2G20850 Length:775 Species:Arabidopsis thaliana


Alignment Length:406 Identity:98/406 - (24%)
Similarity:167/406 - (41%) Gaps:99/406 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 SELRAAPDSSAKVNNGPPFPSSSGVSNSNNNRTSTTATEEIPSLESLGNIHISTVQRAAESLLE- 200
            |:|....:.|.    |......|...:.|.|.........||.::.:    |:.....||:.|: 
plant   395 SKLHGGAERSV----GSESKQESHEIDMNGNAMDLMHPSSIPPIKRV----IAKATEPAEASLKR 451

  Fly   201 --------------IDYAELENATDGWSPDNRLGQGGFGDVYR-----GKWKQLDVAIKVMNYRS 246
                          ...|.|:..|:.:|.:|.:|.|..|.|||     ||.    .|::.::.:|
plant   452 TTSKSHGPLTAVKHFTVASLQQHTNSFSHENLIGTGMLGSVYRAELPGGKL----FAVRKLDKKS 512

  Fly   247 PNIDQ--KMVELQQSYNELKYLNSIRHDNILALYGYSIKGGKPCLVYQLMKGGSL------EARL 303
            ||.::  |.:||      :..::.|||.||:.|.|:..:..:..|:::..:.|:|      :.||
plant   513 PNHEEEGKFLEL------VNNIDRIRHANIVQLVGFCSEHSQRLLIHEYCRNGTLHDLLHIDDRL 571

  Fly   304 RAHKAQNPLPALTWQQRFSISLGTARGIYFLHTARGTPLIHGDIKPANILLDQCLQPKIGDFGLV 368
            :..        |:|..|..|:|..|:.:.:||.....|.||.:.|.||||||..::..:.|.||.
plant   572 KIE--------LSWNVRVRIALEAAKALEYLHEICDPPSIHRNFKSANILLDDDIRVHVSDCGLA 628

  Fly   369 REGPKSLDAVVEVNKVFGTKI----YLPPEFRNFRQLSTGVDVYSFGIVLLEVFTGRQVTDRVPE 429
                 .|.:...|:::.|..:    |..||| .:...:...||||||:|:||:.|||:..|:   
plant   629 -----PLISSGAVSQLSGQLLAAYGYGAPEF-EYGIYTMKCDVYSFGVVMLELLTGRKSYDK--- 684

  Fly   430 NETKKNLLDYVKQQWRQNRMELLEKHLAAPMGKELDMCMCAIEAGL-----------------HC 477
                           :::|.|......|.|...::|.....::..|                 .|
plant   685 ---------------KRDRGEQFLVRWAIPQLHDIDALAKMVDPSLKGDYPAKSLSHFADVISRC 734

  Fly   478 TALDPQDRPSMNAVLK 493
            ...:|:.||.|:.|::
plant   735 VQSEPEYRPLMSEVVQ 750

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 80/309 (26%)
TyrKc 219..495 CDD:197581 80/309 (26%)
SRF1NP_565489.2 LRRNT_2 34..74 CDD:285463
leucine-rich repeat 102..123 CDD:275380
leucine-rich repeat 124..148 CDD:275380
leucine-rich repeat 149..171 CDD:275380
leucine-rich repeat 172..195 CDD:275380
leucine-rich repeat 196..216 CDD:275380
leucine-rich repeat 218..241 CDD:275380
UPF0560 <318..>357 CDD:287538
PKc_like 484..755 CDD:304357 80/309 (26%)
Pkinase_Tyr 484..752 CDD:285015 80/309 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.960

Return to query results.
Submit another query.