DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and Kin3

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_565408.1 Gene:Kin3 / 816227 AraportID:AT2G17220 Length:414 Species:Arabidopsis thaliana


Alignment Length:386 Identity:123/386 - (31%)
Similarity:186/386 - (48%) Gaps:48/386 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 PTISELRAAPDSSAKVNNGPPFPSSSGVSNSNNNRTSTTATEEIPSLESLGNIHISTVQRA---- 194
            |:.|.....|.|:..:       ||.|...|:|| |:||.|....::.|.....:::.:.|    
plant     8 PSDSPPTTTPSSTGNI-------SSVGTFKSSNN-TTTTGTSRGSNISSNSGFSVASGEDAYPDG 64

  Fly   195 ----AESLLEIDYAELENATDGWSPDNRLGQGGFGDVYRGKW-------KQLD---VAIKVMNYR 245
                ..:|.....|||..:|..:..:|.||:||||.|::| |       ||.:   :|:|.:|..
plant    65 QILPIPNLRIFSLAELRASTRNFRSENVLGEGGFGKVFKG-WLEDKTPGKQSNGTVIAVKKLNAE 128

  Fly   246 SPNIDQKMVELQQSYNELKYLNSIRHDNILALYGYSIKGGKPCLVYQLMKGGSLEARL-RAHKAQ 309
            |   .|...|.|   .|:.:|..:.|.|::.|.||.::|.:..|||:.|:.||||..| |...|.
plant   129 S---FQGFEEWQ---CEVNFLGRVSHPNLVKLLGYCLEGEELLLVYEYMQKGSLENHLFRKGSAV 187

  Fly   310 NPLPALTWQQRFSISLGTARGIYFLHTARGTPLIHGDIKPANILLDQCLQPKIGDFGLVREGPKS 374
            .|   |:|:.|..|::|.|:|:.||| |....:|:.|.|.:|||||.....||.||||.:.||.:
plant   188 QP---LSWEIRLKIAIGAAKGLAFLH-ASEKQVIYRDFKASNILLDGSYNAKISDFGLAKLGPSA 248

  Fly   375 LDAVVEVNKVFGTKIYLPPEFRNFRQLSTGVDVYSFGIVLLEVFTGRQVTDRVPENET-KKNLLD 438
            ..:.: ..:|.||..|..||:.....|....|||.||:||.|:.||....|  |...| :.||.:
plant   249 SQSHI-TTRVMGTHGYAAPEYVATGHLYVKSDVYGFGVVLAEILTGLHALD--PTRPTGQHNLTE 310

  Fly   439 YVKQQWRQNR--MELLEKHLAAPMGK-ELDMCMCAIEAGLHCTALDPQDRPSMNAVLKRFE 496
            ::|....:.|  ..:::..|.   || .........:..|.|...:|::||||..|::..|
plant   311 WIKPHLSERRKLRSIMDPRLE---GKYPFKSAFRVAQLALKCLGPEPKNRPSMKEVVESLE 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 101/293 (34%)
TyrKc 219..495 CDD:197581 100/290 (34%)
Kin3NP_565408.1 STYKc 90..367 CDD:214568 101/293 (34%)
STKc_IRAK 93..370 CDD:270968 101/293 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 161 1.000 Inparanoid score I1620
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.920

Return to query results.
Submit another query.