DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and AT2G14440

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001318223.1 Gene:AT2G14440 / 815932 AraportID:AT2G14440 Length:869 Species:Arabidopsis thaliana


Alignment Length:336 Identity:103/336 - (30%)
Similarity:155/336 - (46%) Gaps:54/336 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 RTSTTATEEIPSLESLGNIHISTVQRAAESLLEIDYAELENATDGWSPDNRLGQGGFGDVYRGKW 232
            |.|:|.....||||....              ...|:|::..|:.:  :..||:||||.||.|..
plant   535 RKSSTRKVIRPSLEMKNR--------------RFKYSEVKEMTNNF--EVVLGKGGFGVVYHGFL 583

  Fly   233 KQLDVAIKVMNYRSPNIDQKMVELQQSYNELK----YLNSIRHDNILALYGYSIKGGKPCLVYQL 293
            ....||:||::..|          .|.|.|.|    .|..:.|.|:::|.||..||....|:|:.
plant   584 NNEQVAVKVLSQSS----------TQGYKEFKTEVELLLRVHHVNLVSLVGYCDKGNDLALIYEF 638

  Fly   294 MKGGSLEARLRAHKAQNPLPALTWQQRFSISLGTARGIYFLHTARGTPLIHGDIKPANILLDQCL 358
            |:.|:|:..|...:..   |.|.|..|..|::.:|.||.:||.....|::|.|:|..||||....
plant   639 MENGNLKEHLSGKRGG---PVLNWPGRLKIAIESALGIEYLHIGCKPPMVHRDVKSTNILLGLRF 700

  Fly   359 QPKIGDFGLVREGPKSLDAVVEVNKVFGTKIYLPPEFRNFRQLSTGVDVYSFGIVLLEVFTGRQV 423
            :.|:.||||.|.........|..| |.||..||.||:.....|:...|||||||||||:.||:.|
plant   701 EAKLADFGLSRSFLVGSQTHVSTN-VAGTLGYLDPEYYQKNWLTEKSDVYSFGIVLLEIITGQPV 764

  Fly   424 TDRVPENETKKNLLDYVKQQWRQNRME-LLEKHL-----AAPMGKELDMCMCAIEAGLHCTALDP 482
               :.::..|..::::.|.......:| :::::|     .:...|.|::.|..|         :|
plant   765 ---IEQSRDKSYIVEWAKSMLANGDIESIMDRNLHQDYDTSSSWKALELAMLCI---------NP 817

  Fly   483 QD--RPSMNAV 491
            ..  ||:|..|
plant   818 SSTLRPNMTRV 828

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 93/285 (33%)
TyrKc 219..495 CDD:197581 93/285 (33%)
AT2G14440NP_001318223.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.870

Return to query results.
Submit another query.