DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and AT2G07180

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001189514.1 Gene:AT2G07180 / 815287 AraportID:AT2G07180 Length:442 Species:Arabidopsis thaliana


Alignment Length:344 Identity:109/344 - (31%)
Similarity:170/344 - (49%) Gaps:44/344 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 ATEEIPSLES---LGNIHISTVQRAAESLLEIDYAELENATDGWSPDNRLGQGGFGDVYRG---- 230
            |.:.|..|:|   ..|:.|.|            |.|::.||..:.||..||:||||.||:|    
plant    59 APKNIKDLQSNPGYENVDIFT------------YEEMKIATKQFRPDYILGEGGFGVVYKGVIDE 111

  Fly   231 ----KWKQLDVAIKVMNYRSPNIDQKMVELQQSYNELKYLNSIRHDNILALYGYSIKGGKPCLVY 291
                .:|...||||.:|......|::.:.      |:.||..:.|.|::.|.||..:.....|||
plant   112 SVRVGFKSTKVAIKELNPEGFQGDREWLA------EVNYLGQLSHPNLVKLIGYCCEDDHRLLVY 170

  Fly   292 QLMKGGSLEARLRAHKAQNPLPALTWQQRFSISLGTARGIYFLHTARGTPLIHGDIKPANILLDQ 356
            :.|..||||    .|..:.....|||.:|..|:|..|:|:.|||.|..: :|:.|:|.||||||:
plant   171 EYMAMGSLE----KHLFRRVGCTLTWTKRMKIALDAAKGLAFLHGAERS-IIYRDLKTANILLDE 230

  Fly   357 CLQPKIGDFGLVREGPKSLDAVVEVNKVFGTKIYLPPEFRNFRQLSTGVDVYSFGIVLLEVFTGR 421
            ....|:.||||.::||:. |......:|.||..|..||:.....|::..|||.||::|||:..|:
plant   231 GYNAKLSDFGLAKDGPRG-DQTHVSTRVMGTYGYAAPEYVMTGHLTSRSDVYGFGVLLLEMLLGK 294

  Fly   422 QVTDRVPENETKKNLLDYVKQQWRQNR--MELLEKHLAAPMGKELDMCMCAIEAGL--HCTALDP 482
            :..|: .....:.||:::.:.....|:  :.:::..:....|.:..|.:    |||  .|.:.:|
plant   295 RAMDK-SRACREHNLVEWARPLLNHNKKLLRIIDPRMDGQYGTKALMKV----AGLAYQCLSQNP 354

  Fly   483 QDRPSMNAVLKRFEPFVTD 501
            :.||.||.|::..|....|
plant   355 KGRPLMNHVVEVLETLKDD 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 95/290 (33%)
TyrKc 219..495 CDD:197581 94/287 (33%)
AT2G07180NP_001189514.1 STKc_IRAK 96..370 CDD:270968 95/290 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 161 1.000 Inparanoid score I1620
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.920

Return to query results.
Submit another query.