DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and RIPK

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_178651.1 Gene:RIPK / 815147 AraportID:AT2G05940 Length:462 Species:Arabidopsis thaliana


Alignment Length:341 Identity:107/341 - (31%)
Similarity:170/341 - (49%) Gaps:45/341 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 NNRTSTTATEEIPSLESLGNIHISTVQRAAESLLEIDYAELENATDGWSPDNRLGQGGFGDVYRG 230
            :|.:|.|.:|::....:..::|:.|:            |||:..|..:|..|.||:||||.|::|
plant    52 SNPSSNTLSEDLSISLAGSDLHVFTL------------AELKVITQSFSSTNFLGEGGFGPVHKG 104

  Fly   231 --------KWKQLDVAIKVMNYRSPNIDQKMVELQ---QSYNELKYLNSIRHDNILALYGYSIKG 284
                    ..|...||:|:::...         ||   :...|:.:|..::|.|::.|.||..:.
plant   105 FIDDKLRPGLKAQPVAVKLLDLEG---------LQGHREWLTEVMFLGQLKHKNLVKLIGYCCEE 160

  Fly   285 GKPCLVYQLMKGGSLEARL-RAHKAQNPLPALTWQQRFSISLGTARGIYFLHTARGTPLIHGDIK 348
            ....|||:.|..||||.:| |.:.|     :|.|..|..|:.|.|.|:.|||.|. .|:|:.|.|
plant   161 EHRTLVYEFMPRGSLENQLFRRYSA-----SLPWSTRMKIAHGAATGLQFLHEAE-NPVIYRDFK 219

  Fly   349 PANILLDQCLQPKIGDFGLVREGPKSLDAVVEVNKVFGTKIYLPPEFRNFRQLSTGVDVYSFGIV 413
            .:|||||.....|:.||||.::||:..|..|. .:|.||:.|..||:.....|:...||||||:|
plant   220 ASNILLDSDYTAKLSDFGLAKDGPEGDDTHVS-TRVMGTQGYAAPEYIMTGHLTARSDVYSFGVV 283

  Fly   414 LLEVFTGRQVTDRVPENETKKNLLDYVKQQWRQNR--MELLEKHLAAPMGKELDMCMCAIEAGLH 476
            |||:.|||:..|: ..:..::||:|:.:......|  ..:::..|.....:  .....|......
plant   284 LLELLTGRRSVDK-KRSSREQNLVDWARPMLNDPRKLSRIMDPRLEGQYSE--TGARKAATLAYQ 345

  Fly   477 CTALDPQDRPSMNAVL 492
            |.:..|::||.|:||:
plant   346 CLSHRPKNRPCMSAVV 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 95/288 (33%)
TyrKc 219..495 CDD:197581 95/288 (33%)
RIPKNP_178651.1 STKc_IRAK 93..367 CDD:270968 95/288 (33%)
TyrKc 93..364 CDD:197581 95/288 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 161 1.000 Inparanoid score I1620
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
33.010

Return to query results.
Submit another query.