DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and Irak3

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_082955.2 Gene:Irak3 / 73914 MGIID:1921164 Length:609 Species:Mus musculus


Alignment Length:510 Identity:141/510 - (27%)
Similarity:214/510 - (41%) Gaps:90/510 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 RTRSRSHLDNTMAIRLLPLPVRAQLCAHLDALD---VWQQLATAVKLYPDQVEQISSQKQRGRSA 82
            |..:|..|...:.:..||..:..:||..||:.|   .|:.||..:......|..|.....:|:|.
Mouse     4 RCGARGALSPQLLLFDLPPALLGELCGILDSCDGPLGWRGLAERLSNSWLDVRHIEKYVNQGKSG 68

  Fly    83 SNEFLNIWGGQYNHTVQTLFALFKKLKLHNAMRLIKDY-VSEDLHKYIPRSVPTISELRAAPDSS 146
            :.|.|..| .|.|.|:..|..:.:.:....|:.||.:| ||     :.| ||.|..||       
Mouse    69 TRELLWSW-AQKNKTIGDLLEVLQDMGHQRAIHLIINYGVS-----WTP-SVQTHHEL------- 119

  Fly   147 AKVNNGPPFPSSSGVSNSNNNRTSTTATEEIPSLESLGNIHISTV------QRAAESLLEIDYAE 205
                   ||||..       ........|..|......|:.:..|      ::.......|.:..
Mouse   120 -------PFPSFP-------PEVKHACRENDPGPLEPANVTVDNVLVPEHNEKGTLQKTPISFQS 170

  Fly   206 LENATDGWSPDNRLGQGGFGDVYRGKWKQLDVAIKVMNYRSPNIDQKMVELQQSY----NELKYL 266
            :...|..:..|..:|:|...:|||...:....|:|:..      .:|.::|::.:    :||:.|
Mouse   171 ILEGTKHFHKDFLIGEGEIFEVYRVDIRNQAYAVKLFK------QEKKMQLKKHWKRFLSELEVL 229

  Fly   267 NSIRHDNILALYGYSIKGGKPCLVYQLMKGGSLEARLRAHKAQNPLPALTWQQRFSISLGTARGI 331
            ...||.:||.|..|..:..|.||||..|..|:|..||:......|   |:|..|.|:.:|.|:.|
Mouse   230 LLFRHPHILELAAYFTETEKLCLVYPYMSNGTLFDRLQCTNGTTP---LSWHVRISVLIGIAKAI 291

  Fly   332 YFLHTARGTPLIHGDIKPANILLDQCLQPKIGDFGLVREGPKSLDAVVEVNKVFGTK---IYLPP 393
            .:||..:...:|.|::..||||||..||||:.||......|........:|...|.:   .|:|.
Mouse   292 QYLHNTQPCAVICGNVSSANILLDDQLQPKLTDFAAAHFRPNLEQQSSTINMTGGGRKHLWYMPE 356

  Fly   394 EFRNFRQLSTGVDVYSFGIVLLEVFTGRQVTDRVPENETKKNLLDYVKQQWRQNRMELLEKHLAA 458
            |:....:||...||||||||::||.||.:|....|::...::||           |||:||    
Mouse   357 EYIRQGRLSVKTDVYSFGIVIMEVLTGCKVVLDDPKHVQLRDLL-----------MELMEK---- 406

  Fly   459 PMGKELDMCMCAIE-----------------AGLHCTALDPQDRPSMNAVLKRFE 496
               :.||.|:..::                 || .|.|...:.||:|:.||...|
Mouse   407 ---RGLDSCLSFLDRKIPPCPRNFSAKLFSLAG-RCVATKAKLRPTMDEVLSSLE 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021 27/99 (27%)
STKc_IRAK 219..498 CDD:270968 94/302 (31%)
TyrKc 219..495 CDD:197581 93/299 (31%)
Irak3NP_082955.2 Death_IRAK-M 16..102 CDD:260062 22/86 (26%)
PK_IRAK3 184..459 CDD:271062 94/302 (31%)
Pkinase_Tyr 184..456 CDD:285015 93/299 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167843180
Domainoid 1 1.000 144 1.000 Domainoid score I4588
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D181682at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm43176
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.