DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and RIPK4

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_065690.2 Gene:RIPK4 / 54101 HGNCID:496 Length:784 Species:Homo sapiens


Alignment Length:298 Identity:103/298 - (34%)
Similarity:140/298 - (46%) Gaps:50/298 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 GWSPDNRLGQGGFGDVYRGK---WKQLDVAIKVMNYRSPNI---DQKMVELQQSYNELKYLNSIR 270
            ||   .::|.||||.||:.:   ||.. :|||.    ||::   |::.:||.:   |.|.:...:
Human    24 GW---EKVGSGGFGQVYKVRHVHWKTW-LAIKC----SPSLHVDDRERMELLE---EAKKMEMAK 77

  Fly   271 HDNILALYGYSIKGGKPC-----LVYQLMKGGSLEARLRAHKAQNPLPALTWQQRFSISLGTARG 330
            ...||.:||.       |     ||.:.|:.||||..|    |..|||   |..||.|...||.|
Human    78 FRYILPVYGI-------CREPVGLVMEYMETGSLEKLL----ASEPLP---WDLRFRIIHETAVG 128

  Fly   331 IYFLHTARGTPLIHGDIKPANILLDQCLQPKIGDFGLVREGPKSLDAVVEVNKVFGTKIYLPPE- 394
            :.||| ....||:|.|:||||||||.....||.||||.:....|....:.::.:|||..||||| 
Human   129 MNFLH-CMAPPLLHLDLKPANILLDAHYHVKISDFGLAKCNGLSHSHDLSMDGLFGTIAYLPPER 192

  Fly   395 -FRNFRQLSTGVDVYSFGIVLLEVFTGRQVTDRVPENETKKNLLDYVKQQWRQNRMELLEKHLAA 458
             ....|...|..|||||.||:..|     :|.:.|..: :||:|..:.:..:.:|.||.....|.
Human   193 IREKSRLFDTKHDVYSFAIVIWGV-----LTQKKPFAD-EKNILHIMVKVVKGHRPELPPVCRAR 251

  Fly   459 PMGKELDMCMCAIEAGLHCTALDPQDRPSMNAVLKRFE 496
            |..     |...|.....|...||:.||:...:....|
Human   252 PRA-----CSHLIRLMQRCWQGDPRVRPTFQEITSETE 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 101/291 (35%)
TyrKc 219..495 CDD:197581 100/288 (35%)
RIPK4NP_065690.2 STKc_RIP4_like 25..290 CDD:270927 102/297 (34%)
STYKc 26..279 CDD:214568 100/286 (35%)
ANK 413..524 CDD:238125
ANK repeat 437..468 CDD:293786
Ank_2 442..534 CDD:289560
ANK repeat 470..501 CDD:293786
ANK 471..589 CDD:238125
ANK repeat 503..534 CDD:293786
Ank_2 508..600 CDD:289560
ANK repeat 536..567 CDD:293786
ANK repeat 569..600 CDD:293786
ANK 598..723 CDD:238125
ANK repeat 603..634 CDD:293786
Ank_2 608..699 CDD:289560
ANK repeat 636..667 CDD:293786
ANK repeat 669..699 CDD:293786
Ank_2 674..764 CDD:289560
ANK 729..>764 CDD:238125
ANK repeat 734..764 CDD:293786
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.