DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and PERK14

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001320117.1 Gene:PERK14 / 3770575 AraportID:AT4G32710 Length:731 Species:Arabidopsis thaliana


Alignment Length:380 Identity:111/380 - (29%)
Similarity:175/380 - (46%) Gaps:72/380 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 APDSSAKVNNGPP-----FPSSSGVSNSNNNRTSTTATEEIPSLESLGNIHISTVQRAAESLLEI 201
            |..:.|.|...||     :.||.|.....||  |......:||    |               ..
plant   334 AGTNQAHVITMPPPIHAKYISSGGCDTKENN--SVAKNISMPS----G---------------MF 377

  Fly   202 DYAELENATDGWSPDNRLGQGGFGDVYRGKWKQ-LDVAIKVMNYRSPNIDQKMVELQQSYNELKY 265
            .|.||..||.|:|.:|.||:||||.|::|..|. .:||:|.:...|...::   |.|.   |:..
plant   378 SYEELSKATGGFSEENLLGEGGFGYVHKGVLKNGTEVAVKQLKIGSYQGER---EFQA---EVDT 436

  Fly   266 LNSIRHDNILALYGYSIKGGKPCLVYQLMKGGSLEARLRAHKAQNPLPALTWQQRFSISLGTARG 330
            ::.:.|.::::|.||.:.|.|..|||:.:...:||..|..::..    .|.|:.|..|::|.|:|
plant   437 ISRVHHKHLVSLVGYCVNGDKRLLVYEFVPKDTLEFHLHENRGS----VLEWEMRLRIAVGAAKG 497

  Fly   331 IYFLHTARGTPLIHGDIKPANILLDQCLQPKIGDFGLVREGPKSLDAVVEVN-KVFGTKIYLPPE 394
            :.:||......:||.|||.||||||...:.|:.||||.:....:..:...:: :|.||..|:.||
plant   498 LAYLHEDCSPTIIHRDIKAANILLDSKFEAKVSDFGLAKFFSDTNSSFTHISTRVVGTFGYMAPE 562

  Fly   395 FRNFRQLSTGVDVYSFGIVLLEVFTGRQVTDRVPENETKKNLLDYVKQQWRQNRMELLEKHLAAP 459
            :.:..:::...||||||:||||:.|||. :....::.|.::|:|:.:        .||.|.::  
plant   563 YASSGKVTDKSDVYSFGVVLLELITGRP-SIFAKDSSTNQSLVDWAR--------PLLTKAIS-- 616

  Fly   460 MGKELD------------------MCMCAIEAGLHCTALDPQDRPSMNAVLKRFE 496
             |:..|                  |..||..    |.......||.|:.|::..|
plant   617 -GESFDFLVDSRLEKNYDTTQMANMAACAAA----CIRQSAWLRPRMSQVVRALE 666

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 89/298 (30%)
TyrKc 219..495 CDD:197581 88/295 (30%)
PERK14NP_001320117.1 STKc_IRAK 395..667 CDD:270968 89/298 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.