DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and PERK9

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001320810.1 Gene:PERK9 / 3767664 AraportID:AT1G68690 Length:708 Species:Arabidopsis thaliana


Alignment Length:440 Identity:120/440 - (27%)
Similarity:182/440 - (41%) Gaps:92/440 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 PRSVPTISELRAAPDSSAKVNNGPPF-PSSSGVSNSNNNRTSTTAT------------------- 174
            |||.|.|    ..|.|:....|.|.. |.....:::||:...|.|.                   
plant   240 PRSPPEI----LVPGSNNPSQNNPTLRPPLDAPNSTNNSGIGTGAVVGISVAVALVVFTLFGIFV 300

  Fly   175 ------EEIPSLESLGNIHISTVQRAA--------------------------------ESLLEI 201
                  |:..|..|.|::..|.:...|                                .|....
plant   301 WCLRKREKRLSAVSGGDVTPSPMSSTARSDSAFFRMQSSAPVGASKRSGSYQSQSGGLGNSKALF 365

  Fly   202 DYAELENATDGWSPDNRLGQGGFGDVYRGKWKQ-LDVAIKVMNYRSPNIDQKMVELQQSYNELKY 265
            .|.||..||:|:|.:|.||:||||.||:|.... ..||:|.:.......|::...      |::.
plant   366 SYEELVKATNGFSQENLLGEGGFGCVYKGILPDGRVVAVKQLKIGGGQGDREFKA------EVET 424

  Fly   266 LNSIRHDNILALYGYSIKGGKPCLVYQLMKGGSLEARLRAHKAQNPLPALTWQQRFSISLGTARG 330
            |:.|.|.:::::.|:.|.|.:..|:|..:....|...|...|:     .|.|..|..|:.|.|||
plant   425 LSRIHHRHLVSIVGHCISGDRRLLIYDYVSNNDLYFHLHGEKS-----VLDWATRVKIAAGAARG 484

  Fly   331 IYFLHTARGTPLIHGDIKPANILLDQCLQPKIGDFGLVREGPKSLDAVVEV-NKVFGTKIYLPPE 394
            :.:||......:||.|||.:||||:.....::.||||.|   .:||....: .:|.||..|:.||
plant   485 LAYLHEDCHPRIIHRDIKSSNILLEDNFDARVSDFGLAR---LALDCNTHITTRVIGTFGYMAPE 546

  Fly   395 FRNFRQLSTGVDVYSFGIVLLEVFTGRQVTDRVPENETKKNLLDYVKQQWRQ----NRMELLE-K 454
            :.:..:|:...||:|||:||||:.|||:..|      |.:.|.|....:|.:    :.:|..| .
plant   547 YASSGKLTEKSDVFSFGVVLLELITGRKPVD------TSQPLGDESLVEWARPLISHAIETEEFD 605

  Fly   455 HLAAPM--GKELDMCMC-AIEAGLHCTALDPQDRPSMNAVLKRFEPFVTD 501
            .||.|.  |..::..|. .|||...|.......||.|..:::.||....:
plant   606 SLADPKLGGNYVESEMFRMIEAAGACVRHLATKRPRMGQIVRAFESLAAE 655

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 91/288 (32%)
TyrKc 219..495 CDD:197581 89/285 (31%)
PERK9NP_001320810.1 STKc_IRAK 383..652 CDD:270968 91/288 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.870

Return to query results.
Submit another query.