DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and ripk2

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_919392.2 Gene:ripk2 / 373874 ZFINID:ZDB-GENE-030902-3 Length:584 Species:Danio rerio


Alignment Length:358 Identity:93/358 - (25%)
Similarity:155/358 - (43%) Gaps:93/358 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 SLESLGNIHISTVQRAAESLLEIDYAELENATDGWSPDNRLGQGGFGDVYRGK---WKQLDVAIK 240
            ::|..|.::|.::   ..:|..|.|.:|.:.       :.:.:||||.|:|.:   |: ..||||
Zfish     4 NMEHTGCVNICSL---TSTLPVIPYRKLTDL-------HYISKGGFGTVFRAQHSDWR-TTVAIK 57

  Fly   241 VMNYRSPNIDQKMVELQQSYNELKYLNSIRHDNILALYGYSIKGGKPCLVYQLMKGGSLEARLRA 305
            .:...|| :.::  |......|.:.|:..|.::|:.::|...:....|::.:.|..|||:..|  
Zfish    58 CLKLDSP-VGER--ERNCLLKEAEVLHKARFNHIIQIFGVCNEPEFFCIITEYMTNGSLDELL-- 117

  Fly   306 HKAQNPLPALTWQQRFSISLGTARGIYFLHTARGTPLIHGDIKPANILLDQCLQPKIGDFGL--- 367
            |: ::..||:.|..|..|....|.|:.|||. ...||:|.|:|..|||:|.....||.||||   
Zfish   118 HE-KDIYPAVAWPLRLRILYEIALGVNFLHN-MSPPLLHHDLKTQNILMDGEYHVKIADFGLSKW 180

  Fly   368 ----VREGPKSLDAVVEVNKVFGTKIYLPPEF---RNFRQLSTGVDVYSFGIVLLEVFTGRQVTD 425
                :.:|..|..|     ::.||.||:|||.   ...|:.....|:||:.|::.||     ::.
Zfish   181 RQLSITKGSGSKPA-----EMGGTVIYMPPEEYEPSKTRRTDVKYDMYSYAIIMWEV-----LSR 235

  Fly   426 RVPENETKKNLLDYVKQQWRQNRMELLEKHL--AAPMGKELDMCMCAIEAGLHCTALD------- 481
            |:|..|.             .|.|:::...|  |.|            :.||....:|       
Zfish   236 RIPFEEA-------------TNPMQIMFSVLRGARP------------DTGLDSLPVDIPSRETL 275

  Fly   482 -----------PQDRPS-------MNAVLKRFE 496
                       |.:|||       :..:|:||:
Zfish   276 INLMTSGWTANPDERPSFLHCLIELEPMLRRFD 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 86/318 (27%)
TyrKc 219..495 CDD:197581 84/315 (27%)
ripk2NP_919392.2 STKc_RIP2 30..313 CDD:270928 86/329 (26%)
S_TKc 34..297 CDD:214567 83/305 (27%)
CARD_RIP2_CARD3 471..557 CDD:176764
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.