DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and Irak2

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001020593.1 Gene:Irak2 / 362418 RGDID:1309584 Length:624 Species:Rattus norvegicus


Alignment Length:527 Identity:141/527 - (26%)
Similarity:221/527 - (41%) Gaps:95/527 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 MAIRLLPLP--VRAQLCAHLDALDVWQQLATAVKLYPD--QVEQISS-QKQRGRSASNEFLNIWG 91
            ||..:..||  |...||.::|.|..|..:..|..:..|  |:.:|.| ::.:|.|.:.|.| .|.
  Rat     1 MACYIYQLPSWVLDDLCRNIDTLSEWDWMQFASYVITDLTQLRKIKSMERVQGVSITRELL-WWW 64

  Fly    92 GQYNHTVQTLFALFKKLKLHNAMRLIKDYVSEDLHKYIPRSVPTISELRAAPDSSAKVNNGPPFP 156
            .....|||.|..|...|:|:.|.:::..:      |..|.|   :|.|.|.|::   |..||...
  Rat    65 SMRQATVQQLVDLLCHLELYRAAQIVLSW------KPAPDS---LSPLSAFPEA---VKPGPVAT 117

  Fly   157 S--------------------SSGVSNSNNNRTST---TATEEIP-SL-----ESLGNIHISTVQ 192
            |                    |||.:.:...:.::   ...|:.| ||     :||.:.:.||..
  Rat   118 SGRNLKDDQKKGQPVKPCSFLSSGTTMAGAQQQASCQRPCEEDAPCSLKTDVPDSLQSKYCSTSI 182

  Fly   193 RAAESLLEI-------DYAELENATDGWSPDNRLGQGGFGDVYRGKWKQLDVAIKVMNYRSPNID 250
            ...|.||.:       ..|::..||:.:...:|:.:|.|.|:|||:...:..|.|.:...:.:..
  Rat   183 PKQEKLLNLPGDRLFWSEADIVQATEDFDQSHRISEGTFADIYRGQRNGVAFAFKRLREVTGSSP 247

  Fly   251 QKMVELQQSYNELKYLNSIRHDNILALYGYSIKGGKPCLVYQLMKGGSLEARLRAHKAQNPLPAL 315
            ..|....|:  |::......|.|||.|.|:........|:|..|..|||:.||   .||.....|
  Rat   248 GSMDRFLQA--EMQLCLRCCHPNILPLLGFCTGRQFHSLIYPYMANGSLQDRL---WAQGDSDML 307

  Fly   316 TWQQRFSISLGTARGIYFLHTARGTPLIHGDIKPANILLDQCLQPKIGDFGLVREGP---KSLDA 377
            :|.||.||..|....:..||:   ..:||.::|.||:||||.|.||:. ..:....|   |:...
  Rat   308 SWPQRASICSGLLLAVEHLHS---LDIIHSNVKSANVLLDQHLNPKLA-HPVAHPCPTNKKTKYT 368

  Fly   378 VVEVNKVFGTKIYLPPEFRNFRQLSTGVDVYSFGIVLLEVFTGRQVTDR--------------VP 428
            |::.:....:..|||..|....||:..||::|.||||.||.||....|:              :|
  Rat   369 VMKTHLFQASAAYLPENFIRVGQLTKQVDIFSCGIVLAEVLTGIPAMDKDRSPVYLKDLLLSEIP 433

  Fly   429 ENETK---------KNLLDYVKQQWRQNRMELLEKHLAAPMGKELDMCMCAIEAGLHCTALDPQD 484
            .|.:.         |.::..:.|:..:.:..||.:..|......:.:|:...||.|.      :.
  Rat   434 SNTSSVHSRKTSMGKVVVKEICQKHLERKAGLLPEACAETWATAVSVCLRRREASLE------EA 492

  Fly   485 RPSMNAV 491
            |.||..|
  Rat   493 RVSMAGV 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021 28/100 (28%)
STKc_IRAK 219..498 CDD:270968 84/299 (28%)
TyrKc 219..495 CDD:197581 84/299 (28%)
Irak2NP_001020593.1 Death_IRAK2 3..91 CDD:176773 26/88 (30%)
PKc_like 216..504 CDD:419665 84/299 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 508..536
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 549..593
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346685
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D181682at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.