DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and Haspin

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001015349.2 Gene:Haspin / 3355064 FlyBaseID:FBgn0046706 Length:566 Species:Drosophila melanogaster


Alignment Length:355 Identity:65/355 - (18%)
Similarity:114/355 - (32%) Gaps:144/355 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 RLGQGGFGDVYRGKWKQ-------LDVAIKVMNYRSPNIDQKMVELQQSYNEL-------KYLNS 268
            ::|:|.:|:|:|....|       .|:.:|::......:...  |.|::::::       |.:.|
  Fly   253 KIGEGAYGEVFRCSRNQEVLKDHISDIVLKIIPLEGSTVING--EKQKTFSQILPEIIITKKMCS 315

  Fly   269 IRHDNILALYGY-------SIKGGKP-----------------------------CLVYQLMKGG 297
            :|.....:..|:       .:||..|                             ..|.:|...|
  Fly   316 LRTSKTNSTNGFVSIQKVSLVKGRYPPHFIKLWEKYDNEKGSENDHPELFGDNQLFAVLELKFAG 380

  Fly   298 SLEARLRAHKAQNPLPALTWQQRFSISLGTARGIYFLHTARGTPLIHGDIKPANILLDQCLQPKI 362
            |..|..:...::....||   |:..::|......|...        |.|:...|||::       
  Fly   381 SDMANFKFLNSEQSYYAL---QQIILALAVGEEEYQFE--------HRDLHLGNILIE------- 427

  Fly   363 GDFGLVREGPKSLDAVVEVNKVFGTKIYLPPEFR--NFRQLSTGVDV----YSFGIVLL------ 415
                                  :..|.::...|:  |...||.||:|    |:...|.:      
  Fly   428 ----------------------YTNKKHIVCTFKSSNLTLLSKGVNVTIIDYTLSRVTINDCCYF 470

  Fly   416 -------EVF--TGRQVTD--RVPENETKKN-------------------LLDYVKQQ---WRQN 447
                   |:|  ||....|  |:..||.|.|                   :||.||.:   .:.:
  Fly   471 NDLSRDEELFQATGDYQYDVYRMMRNELKNNWSSFSPKTNIIWLSYVIVKVLDSVKYKSINTKVH 535

  Fly   448 RMELLEKHLAAPMGKELDMCMCAIEAGLHC 477
            || .::|.      |||...:...|:..||
  Fly   536 RM-YIDKI------KELKNIIMTFESASHC 558

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 65/354 (18%)
TyrKc 219..495 CDD:197581 65/354 (18%)
HaspinNP_001015349.2 PKc_like 252..>426 CDD:304357 31/185 (17%)
DUF3635 479..>545 CDD:289128 17/72 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458004
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24419
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.