DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and AT3G46355

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001327918.1 Gene:AT3G46355 / 28719382 AraportID:AT3G46355 Length:291 Species:Arabidopsis thaliana


Alignment Length:285 Identity:87/285 - (30%)
Similarity:128/285 - (44%) Gaps:54/285 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   219 LGQGGFGDVYRGKWKQLD----VAIKVMNYRSPNIDQKMVELQQSYNELKYLNSIRHDNILALYG 279
            ||:||||.||.|   .||    ||:||                      ..|..:.|.|:|.|.|
plant     9 LGEGGFGTVYHG---DLDSSQQVAVKV----------------------DLLLRVHHINLLNLVG 48

  Fly   280 YSIKGGKPCLVYQLMKGGSLEARLRAHKAQNPLPALTWQQRFSISLGTARGIYFLHTARGTPLIH 344
            |..:.....|:|:.|..|.|:..|......:   .|:|..|..|::..|.|:.:||......::|
plant    49 YCDERDHLALIYEYMSNGDLKHHLSGEHGGS---VLSWNIRLRIAVDAALGLEYLHIGCRPSMVH 110

  Fly   345 GDIKPANILLDQCLQPKIGDFGLVRE----GPKSLDAVVEVNKVFGTKIYLPPEFRNFRQLSTGV 405
            .|:|..|||||:....||.||||.|.    |...:..||.     |:..||.||.....::|   
plant   111 RDVKSTNILLDENFMAKIADFGLSRSFILGGESHVSTVVA-----GSLGYLDPETSRLAEMS--- 167

  Fly   406 DVYSFGIVLLEVFTGRQVTDRVPENETKKNLLDYVKQQWRQNR---MELLEKHLAAPMGKELDMC 467
            |||||||||||:.|.::|.|:..|   |.::.::.  .:..||   ..:::.:|.......  ..
plant   168 DVYSFGIVLLEIITNQRVIDKTRE---KPHITEWT--AFMLNRGDITRIMDPNLNGDYNSH--SV 225

  Fly   468 MCAIEAGLHCTALDPQDRPSMNAVL 492
            ..|:|..:.|.....::||||:.|:
plant   226 WRALELAMSCANPSSENRPSMSQVV 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 87/285 (31%)
TyrKc 219..495 CDD:197581 87/285 (31%)
AT3G46355NP_001327918.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.