DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and Irak4

DIOPT Version :10

Sequence 1:NP_476971.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_084202.2 Gene:Irak4 / 266632 MGIID:2182474 Length:459 Species:Mus musculus


Alignment Length:62 Identity:16/62 - (25%)
Similarity:24/62 - (38%) Gaps:21/62 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 DLVLVKALTEMRHWIAENPYIFKCRTDAKFLLRFLRFRQFSVPMACEALERYLTVRELYPGW 101
            :|.|..||..|.     ||.|:...|:           :|.|     |::|....|.::|.|
Mouse   278 NLSLTSALPPML-----NPIIYTFMTE-----------EFMV-----AVKRLFKRRNIFPSW 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_476971.1 Death_Pelle 32..128 CDD:260021 16/62 (26%)
STKc_IRAK 219..498 CDD:270968
Irak4NP_084202.2 Death_IRAK4 9..108 CDD:260060
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 115..161
STKc_IRAK4 170..457 CDD:271060 16/62 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.