DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and Ripk3

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_647558.2 Gene:Ripk3 / 246240 RGDID:628899 Length:478 Species:Rattus norvegicus


Alignment Length:317 Identity:100/317 - (31%)
Similarity:144/317 - (45%) Gaps:74/317 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 AESLLEIDYAELENATDGWSPDNRLGQGGFGDVYRGK---WKQLDVAIKVMNYRSPNIDQKMVEL 256
            |.|:..:...||||.  |:     :|:||||.|:|.:   | .||||:|::|  |..|.:     
  Rat    11 ASSISLVGSEELENL--GF-----VGKGGFGAVFRARHTAW-NLDVAVKIVN--SKKISR----- 60

  Fly   257 QQSYNELKYLNSIRHDNILALYGYS-------IKGGKPCLVYQLMKGGSLEARLRAHKAQNPLPA 314
                 |:|.:.::||:|:|.|.|.:       :.|  |.||...|:.|||...|   :...|.| 
  Rat    61 -----EVKAMVNLRHENVLLLLGVTENLEWDYVYG--PALVTGFMENGSLSGLL---QPSCPRP- 114

  Fly   315 LTWQQRFSISLGTARGIYFLHTARGTPLIHGDIKPANILLDQCLQPKIGDFGLVR--------EG 371
              |.....:......|:.:||:...: |:|.|:||:|:|||..|..|:.||||..        .|
  Rat   115 --WPLLCRLLEEVVLGMCYLHSLNPS-LLHRDLKPSNVLLDPELHAKLADFGLSTFQGGSQSGSG 176

  Fly   372 PKSLDAVVEVNKVFGTKIYLPPE-FRNFRQLSTGVDVYSFGIVLLEVFTGRQVTDRVPENETKKN 435
            ..|.|:       .||..||.|| ..|..:.|...||||||:::..|..||:.     |...|.:
  Rat   177 SGSRDS-------GGTLAYLAPELLDNDGKASKASDVYSFGVLVWTVLAGREA-----EVVDKTS 229

  Fly   436 LLDYVKQQWRQNRMELLEKHLAAPMGKELDMCMCAIEAGL-----HCTALDPQDRPS 487
            |:...... ||.|..|.|....:|....|:        ||     ||.:.:|:||||
  Rat   230 LIRGAVCN-RQRRPPLTELPPDSPETPGLE--------GLKELMTHCWSSEPKDRPS 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 93/293 (32%)
TyrKc 219..495 CDD:197581 93/293 (32%)
Ripk3NP_647558.2 PKc_like 28..285 CDD:419665 93/293 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 311..330
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 362..429
RHIM 408..458 CDD:403811
RIP homotypic interaction motif (RHIM). /evidence=ECO:0000250|UniProtKB:Q9Y572 437..461
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.