DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and Ankk1

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001363880.1 Gene:Ankk1 / 244859 MGIID:3045301 Length:746 Species:Mus musculus


Alignment Length:352 Identity:92/352 - (26%)
Similarity:147/352 - (41%) Gaps:86/352 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 PSLESLGNIHISTVQRAAESLLEIDYAELENATDGWSPDNRLGQGGFGDVYRGKWK--QLDVAIK 240
            |..:.||::.:.|         ..|:.|      .|   :.:..|||..|::.:.|  :...|||
Mouse    17 PLAQQLGSLTVFT---------RDDFEE------EW---HLVASGGFSKVFQARHKRWRTQYAIK 63

  Fly   241 VMNYRSPNIDQKMV--ELQQSYNELKYLNSIRHDNILALYGYSIKGGKPC-----LVYQLMKGGS 298
            .    ||.:.::..  |:...:.|...:..|:..:|:::||.       |     :|.:.|..||
Mouse    64 C----SPCLQKETTSSEVTCLFEEAVKMEKIKFQHIVSIYGV-------CKQPLGIVMEFMASGS 117

  Fly   299 LEARLRAHKAQNPLPALTWQQRFSISLGTARGIYFLHTARGTPLIHGDIKPANILLDQCLQPKIG 363
            ||..|..|       :|.|..:..|...|:..:.|||:.: .||:|.|:||.|||||..:..||.
Mouse   118 LEKTLPTH-------SLCWPLKLRIIHETSLAMNFLHSIK-PPLLHLDLKPGNILLDNNMHVKIS 174

  Fly   364 DFGLVREGPKSLD-AVVEVNKVFGTKIYLPPE--FRNFRQLSTGVDVYSFGIVLLEVFTGRQ--- 422
            ||||.:...:|.. ..:|.:.:.||..|:|||  ..|.:......|||||.||:.|:.|.::   
Mouse   175 DFGLSKWMEQSTQKQYIERSALRGTLSYIPPEMFLENNKAPGPEYDVYSFAIVIWEILTQKKPYA 239

  Fly   423 ------VTDRVPENETKKNLLDYVKQQWRQNRMELLEKHLAAPMGKELDMCMCAIEAGLHCTALD 481
                  :..||... .:.:|.| |..:|.:      |.|....:.|             .|...|
Mouse   240 GLNMMTIIIRVAAG-MRPSLQD-VSDEWPE------EVHQMVNLMK-------------RCWDQD 283

  Fly   482 PQDRP-------SMNAVLKRFEPFVTD 501
            |:.||       ..:.:|..|:..:||
Mouse   284 PKKRPCFLNVAVETDMLLSLFQSPMTD 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 83/306 (27%)
TyrKc 219..495 CDD:197581 82/303 (27%)
Ankk1NP_001363880.1 PKc_like 37..305 CDD:389743 83/310 (27%)
PHA02876 <364..>694 CDD:165207
ANK 1 370..399
ANK repeat 373..401 CDD:293786
ANK repeat 403..434 CDD:293786
ANK 2 403..432
ANK repeat 436..467 CDD:293786
ANK 3 436..465
ANK 4 469..498
ANK repeat 469..497 CDD:293786
ANK repeat 502..532 CDD:293786
ANK 5 502..531
ANK 6 535..564
ANK repeat 537..566 CDD:293786
ANK repeat 568..599 CDD:293786
ANK 7 568..597
ANK 8 601..630
ANK repeat 602..632 CDD:293786
ANK repeat 634..665 CDD:293786
ANK 9 634..663
ANK repeat 667..698 CDD:293786
ANK 10 667..696
Ank_2 672..>742 CDD:372319
ANK repeat 700..730 CDD:293786
ANK 11 700..729
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.