DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and IRAK3

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_009130.2 Gene:IRAK3 / 11213 HGNCID:17020 Length:596 Species:Homo sapiens


Alignment Length:490 Identity:130/490 - (26%)
Similarity:206/490 - (42%) Gaps:95/490 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 LPLPVRAQLCAHLDALD---VWQQLATAVKLYPDQVEQISSQKQRGRSASNEFLNIWGGQYNHTV 98
            ||..:..:|||.||:.|   .|:.||..:......|..|.....:|:|.:.|.|..| .|.|.|:
Human    20 LPPALLGELCAVLDSCDGALGWRGLAERLSSSWLDVRHIEKYVDQGKSGTRELLWSW-AQKNKTI 83

  Fly    99 QTLFALFKKLKLHNAMRLIKDYVSEDLHKYIPRSVPTISELRAAPDSSAKVNNGPP---FPSSSG 160
            ..|..:.:::....|:.||.:|.:.                 .:|...:....|.|   |..::.
Human    84 GDLLQVLQEMGHRRAIHLITNYGAV-----------------LSPSEKSYQEGGFPNILFKETAN 131

  Fly   161 VSNSNNNRTSTTATEEIPSLESLGNIHISTVQRAAESLLEIDYAELENATDGWSPDNRLGQGGFG 225
            |:..|         ..||.....|.:..|:          |.:..:...|..:..|..:|:|...
Human   132 VTVDN---------VLIPEHNEKGILLKSS----------ISFQNIIEGTRNFHKDFLIGEGEIF 177

  Fly   226 DVYRGKWKQLDVAIKVMNYRSPNIDQKMVELQQSY----NELKYLNSIRHDNILALYGYSIKGGK 286
            :|||.:.:.|..|:|:..      .:|.::.::.:    :||:.|....|.|||.|..|..:..|
Human   178 EVYRVEIQNLTYAVKLFK------QEKKMQCKKHWKRFLSELEVLLLFHHPNILELAAYFTETEK 236

  Fly   287 PCLVYQLMKGGSLEARLRAHKAQNPLPALTWQQRFSISLGTARGIYFLHTARGTPLIHGDIKPAN 351
            .||:|..|:.|:|..||:......|||   |..|..|.:|.::.|::||..:...:|.|.|..||
Human   237 FCLIYPYMRNGTLFDRLQCVGDTAPLP---WHIRIGILIGISKAIHYLHNVQPCSVICGSISSAN 298

  Fly   352 ILLDQCLQPKIGDFGLV--REGPKSLDAVVEVNKVFGTKI-YLPPEFRNFRQLSTGVDVYSFGIV 413
            ||||...|||:.||.:.  |...:.....:.:.......: |:|.|:....:||...||||||||
Human   299 ILLDDQFQPKLTDFAMAHFRSHLEHQSCTINMTSSSSKHLWYMPEEYIRQGKLSIKTDVYSFGIV 363

  Fly   414 LLEVFTGRQVTDRVPENETKKNLLDYVKQQWRQNRMELLEKHLAAPMGKELDMCMCAIE------ 472
            ::||.||.:|....|::...::||           .||:||       :.||.|:..::      
Human   364 IMEVLTGCRVVLDDPKHIQLRDLL-----------RELMEK-------RGLDSCLSFLDKKVPPC 410

  Fly   473 -----------AGLHCTALDPQDRPSMNAVLKRFE 496
                       || .|.|...:.||||:.||...|
Human   411 PRNFSAKLFCLAG-RCAATRAKLRPSMDEVLNTLE 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021 26/93 (28%)
STKc_IRAK 219..498 CDD:270968 91/302 (30%)
TyrKc 219..495 CDD:197581 90/299 (30%)
IRAK3NP_009130.2 TyrKc 171..443 CDD:197581 90/299 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 560..596
Death_IRAK-M 15..103 CDD:260062 24/83 (29%)
PK_IRAK3 171..446 CDD:271062 91/302 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153081
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D181682at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm41104
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.