DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TTLL6B and TTLL7

DIOPT Version :9

Sequence 1:NP_651549.1 Gene:TTLL6B / 43282 FlyBaseID:FBgn0039501 Length:720 Species:Drosophila melanogaster
Sequence 2:NP_001337143.1 Gene:TTLL7 / 79739 HGNCID:26242 Length:887 Species:Homo sapiens


Alignment Length:628 Identity:210/628 - (33%)
Similarity:343/628 - (54%) Gaps:76/628 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 MPA--EEAKLQGFIQLNNKTYRVECPTRVLNPPMNVDEERPASET----------KSTIC--VSN 152
            ||:  :|..:||             |:     |::::.|.|...|          |.||.  |:.
Human     1 MPSLPQEGVIQG-------------PS-----PLDLNTELPYQSTMKRKVRKKKKKGTITANVAG 47

  Fly   153 SRYAMIGKISKTLGY-KLVKESKMWNILWSDSFPGVELFKNMKRFQQINHFPGMIEICRKDLLSR 216
            :::.::..:...:|: |...|.:..|::|.||....|....::.:|:|||||||.||||||.|:|
Human    48 TKFEIVRLVIDEMGFMKTPDEDETSNLIWCDSAVQQEKISELQNYQRINHFPGMGEICRKDFLAR 112

  Fly   217 NLNRMLKIFPQDYKIFPKTWMLPADYGDAMNYA--LNHKR---TFILKPDSGAQGRGIWLTNDLK 276
            |:.:|:|..|.||...|:||:.||:|....||.  |..||   |||:||.:||.|.||.|..:..
Human   113 NMTKMIKSRPLDYTFVPRTWIFPAEYTQFQNYVKELKKKRKQKTFIVKPANGAMGHGISLIRNGD 177

  Fly   277 TIGPHERLICQTYIHRPLLIDGYKFDLRVYTLITSVDPLRIFVYNEGLARFATNKYVEPTPGNAN 341
            .:...:.||.|.||.:|.|::|||||||:|.|:||.|||:||:|::||.|..|.||:.|...|..
Human   178 KLPSQDHLIVQEYIEKPFLMEGYKFDLRIYILVTSCDPLKIFLYHDGLVRMGTEKYIPPNESNLT 242

  Fly   342 DLYMHLTNYSVNKRNSHYELCDNDDCGSKRKLSAINNWMRRHNYDVEEFWSNVDDVIIKTVLSAW 406
            .||||||||||||.|.|:|..:.::.||||.:.....:::.:.:||.:|||::.::::||::.|.
Human   243 QLYMHLTNYSVNKHNEHFERDETENKGSKRSIKWFTEFLQANQHDVAKFWSDISELVVKTLIVAE 307

  Fly   407 PVLKHNYHACFPGH--DKIQACFEILGFDILVDWKLKPYILEVNHSPSFHTNEQVDREVKRPLIR 469
            |.:.|.|..|.||.  .....|||:||||||:|.||||::||:|.:|||.|::::|.:|||.::.
Human   308 PHVLHAYRMCRPGQPPGSESVCFEVLGFDILLDRKLKPWLLEINRAPSFGTDQKIDYDVKRGVLL 372

  Fly   470 DTLNLVSTVLADKRQILKEDRKRVKQRLLKIRGDPPVQRPRLGGGTS-----KPKIDAQKGSPDA 529
            :.|.|::...:|||:.|.:.:...::||.   |...::  ||..|:|     :.:::.:|     
Human   373 NALKLLNIRTSDKRRNLAKQKAEAQRRLY---GQNSIK--RLLPGSSDWEQQRHQLERRK----- 427

  Fly   530 QPVDVEPEAEDHGPLAQQIAWEE---SHLGNFRKIMPPPDLSKLDYYTRFYAQSHQVSIFAETAA 591
                 |...|....:.:||:.||   .|:||:|:|.||.|.:.|:.|....|.:.| :..:..||
Human   428 -----EELKERLAQVRKQISREEHENRHMGNYRRIYPPEDKALLEKYENLLAVAFQ-TFLSGRAA 486

  Fly   592 SKKRE--DLARKMR----IQLEEKKAKQQQMLNGKAKRDARKRHTVLLPRAVREKNRINFFRLRE 650
            |.:||  :..::|:    :.|.|:.....:.|.||..:....:....:|.:.....|..:.....
Human   487 SFQRELNNPLKRMKEEDILDLLEQCEIDDEKLMGKTTKTRGPKPLCSMPESTEIMKRPKYCSSDS 551

  Fly   651 NW-SPGFISDAEERLRHTWLHMRAEAIRTLKITENIY-SNLYE 691
            :: |....|:::|..:..:.:.:.|.    ::|.|:. ||.|:
Human   552 SYDSSSSSSESDENEKEEYQNKKREK----QVTYNLKPSNHYK 590

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TTLL6BNP_651549.1 TTL 196..486 CDD:281171 139/296 (47%)
TTLL7NP_001337143.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21 7/37 (19%)
TTL 91..376 CDD:281171 134/284 (47%)
SMC_N <373..>518 CDD:330553 40/160 (25%)
DUF2570 <383..>448 CDD:329230 18/79 (23%)
c-MTBD region. /evidence=ECO:0000269|PubMed:25959773 388..450 15/76 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 519..621 13/76 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 651..676
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2158
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1251554at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5342
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.