DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment TTLL6B and NGRN

DIOPT Version :9

Sequence 1:	NP_651549.1	Gene:	TTLL6B / 43282	FlyBaseID:	FBgn0039501	Length:	720	Species:	Drosophila melanogaster
Sequence 2:	NP_001028260.2	Gene:	NGRN / 51335	HGNCID:	18077	Length:	291	Species:	Homo sapiens

Alignment Length:	119	Identity:	29/119 - (24%)
Similarity:	47/119 - (39%)	Gaps:	23/119 - (19%)

- Green bases have known domain annotations that are detailed below.

  Fly   522 AQKGSPDAQPVDVEPEAE-DHGPLAQQIAWEESHLG------NFRKI--------MPPPDLS--- 568
            |.:|.....|:..||:.: |..|..:::...||.|.      .|:||        .||..|:
Human    23 ATRGVAGPGPIGREPDPDSDWEPEERELQEVESTLKRQKQAIRFQKIRRQMEAPGAPPRTLTWEA 87

  Fly   569 --KLDYYTRFYAQSHQVSIFAE---TAASKKREDLARKMRIQLEEKKAKQQQML 617
              ::.|....:.:|..|...||   .:....|..|..|....||:|..:.|::|
Human    88 MEQIRYLHEEFPESWSVPRLAEGFDVSTDVIRRVLKSKFLPTLEQKLKQDQKVL 141

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
TTLL6B	NP_651549.1	TTL	196..486	CDD:281171
NGRN	NP_001028260.2	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	26..48		6/21 (29%)
		Neugrin	73..291	CDD:283952	16/69 (23%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	155..270
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	1	0.950	-	0	Normalized mean entropy	S4788
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.950