DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TTLL6B and Kprp

DIOPT Version :9

Sequence 1:NP_651549.1 Gene:TTLL6B / 43282 FlyBaseID:FBgn0039501 Length:720 Species:Drosophila melanogaster
Sequence 2:NP_082905.1 Gene:Kprp / 433619 MGIID:1920981 Length:657 Species:Mus musculus


Alignment Length:75 Identity:23/75 - (30%)
Similarity:28/75 - (37%) Gaps:18/75 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 PCLDRE---WFSPEQSPPLQPMS---PRRRMKKTRCLKRRTAAD---------KQVDDNSPYYGP 94
            ||..|:   ...|.|.||.:..|   ||:......|...|..||         .|..|.||   .
Mouse   380 PCCPRQVPPQRCPVQIPPFRGRSQSCPRQPSWGVSCPDLRPRADPHPFPRSCRPQHLDRSP---E 441

  Fly    95 SSGENSPMPA 104
            ||.:..|:||
Mouse   442 SSRQRCPVPA 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TTLL6BNP_651549.1 TTL 196..486 CDD:281171
KprpNP_082905.1 PHA03247 <281..588 CDD:223021 23/75 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 285..320
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 425..493 9/30 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 517..568
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838217
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.