DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TTLL6B and Kprp

DIOPT Version :9

Sequence 1:NP_651549.1 Gene:TTLL6B / 43282 FlyBaseID:FBgn0039501 Length:720 Species:Drosophila melanogaster
Sequence 2:NP_001002290.1 Gene:Kprp / 432393 RGDID:1303244 Length:699 Species:Rattus norvegicus


Alignment Length:111 Identity:27/111 - (24%)
Similarity:36/111 - (32%) Gaps:32/111 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 PEQSPPLQPMSPRRRMKKTRCLKRRTAADKQVDDNSPYYGPS--SGENSPMPAEEAKLQGFIQLN 116
            |:.||..||......|      .|.......|....|.:.||  ||.| |:|             
  Rat   582 PQPSPRSQPCPHPEPM------PRPVPCSSPVPCGDPIHCPSPCSGHN-PVP------------- 626

  Fly   117 NKTYRVECPTRVLNPPMNVDEERPAS------ETKSTICVSNSRYA 156
               |..|......| |..:|.|.|:|      :..:..|||...::
  Rat   627 ---YSQELGCHESN-PCRLDTEGPSSYSFSQGQESNGCCVSGGVFS 668

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TTLL6BNP_651549.1 TTL 196..486 CDD:281171
KprpNP_001002290.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 448..533
Trypan_PARP <572..626 CDD:114603 15/50 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341998
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.