DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TTLL6B and TTLL12

DIOPT Version :9

Sequence 1:NP_651549.1 Gene:TTLL6B / 43282 FlyBaseID:FBgn0039501 Length:720 Species:Drosophila melanogaster
Sequence 2:NP_610325.1 Gene:TTLL12 / 35732 FlyBaseID:FBgn0033225 Length:626 Species:Drosophila melanogaster


Alignment Length:407 Identity:98/407 - (24%)
Similarity:160/407 - (39%) Gaps:103/407 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 MPAEEAKLQG--FIQLNNK-----------TY----RVECPTRVLNPPMNVDEERPASETKSTIC 149
            :|..:|.|.|  |:|:..:           ||    .|..|.|....|:.|..|           
  Fly   229 LPWRDADLTGESFLQVEPRADYFTSGHIPETYPKGDTVPLPARSRCDPLKVYAE----------- 282

  Fly   150 VSNSRYAMIGKISKTLGYKLVKESKMWNILW-SDSFPGVELFKNMKRFQQINHFPGMIEICRKDL 213
                 |.::.:...:..:.||..:...::|| :..|...|.|.:....:.||.||....|..|||
  Fly   283 -----YEVVRRHLTSSEFILVNNADEADVLWLTHHFKNFEDFADRSPGKFINQFPFEYVITIKDL 342

  Fly   214 LSRNLNRMLKIFPQDYKI--FPKTWMLPADYG---DAMNYAL-----------NHKRTFILKPDS 262
            ||....|..|.......:  || .| ||..|.   :...:|.           ||   :|:||.:
  Fly   343 LSIVGRRAAKEHHDSLTLETFP-AW-LPTTYNLSTEVKEFAAYYQTRAAKGLDNH---WIIKPWN 402

  Fly   263 GAQGRGIWLTNDLKTI------GPHERLICQTYIHRPLL-----IDG-YKFDLRVYTLITSVDPL 315
            .|:|....:|:::|.|      ||.   |.|.||.||:|     ::| .|||:|...|:.||.||
  Fly   403 LARGLDTHITDNIKQIVRLPATGPK---IAQKYIERPVLFSRQEVEGSVKFDIRYVILLKSVKPL 464

  Fly   316 RIFVYNEGLARFATNKYVEPTPGNANDLYMHLT--NYSVNKRNSHYELCDNDDCGSKRKLSAINN 378
            :.:::.:...|||.:.:   |..:.:|...|.|  ||. .:...|:..||:          .:..
  Fly   465 KAYIHRKFFLRFANHPF---TLDHFDDYEKHYTVMNYQ-TEAQLHHVKCDD----------FLTL 515

  Fly   379 WMRRHNYDVEEFWSNVDDVIIKTVLSAWPVLKHNYHACFPGHDKIQACFE---ILGFDILVDWK- 439
            |..::   .:..||.::..|...:|............|     .:..|.:   :...||::.|| 
  Fly   516 WQEQY---PDNDWSALEQQICSMLLEVLQCASQADPPC-----GLAPCAQSRALYAADIMLRWKD 572

  Fly   440 -----LKPYILEVNHSP 451
                 ::|.:||:|.:|
  Fly   573 DKEKLMEPQLLEINWTP 589

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TTLL6BNP_651549.1 TTL 196..486 CDD:281171 76/295 (26%)
TTLL12NP_610325.1 ATP-grasp_4 328..613 CDD:302634 76/292 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450521
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.