DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TTLL6B and TTLL3A

DIOPT Version :9

Sequence 1:NP_651549.1 Gene:TTLL6B / 43282 FlyBaseID:FBgn0039501 Length:720 Species:Drosophila melanogaster
Sequence 2:NP_609069.1 Gene:TTLL3A / 33947 FlyBaseID:FBgn0031854 Length:992 Species:Drosophila melanogaster


Alignment Length:437 Identity:100/437 - (22%)
Similarity:182/437 - (41%) Gaps:117/437 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 KSTICV--------------SNSRYAMIGKISKT---LGYKLVKE---------------SKMWN 177
            |.|.||              |::.::..|||..:   ..||.:.|               .|:|.
  Fly   296 KLTACVAFLRAMLCKYHKQGSDAVFSCSGKIPYSAIDFAYKRLVEYIDSCQHNDIDFEDPPKIWE 360

  Fly   178 ILWSDSFPGVELFKNMKRFQQ---INHFPGM-IEICRKDLLSRNLNRMLKIFPQDYKIFPKTWML 238
            ..| |:|    ||::.:...:   |.|..|. :|...|..||. :::|...:||           
  Fly   361 HDW-DAF----LFQHQQLVNEDGRIQHDGGQRLEPMVKSCLSL-VDKMKVHWPQ----------- 408

  Fly   239 PADYGDAMNYALN-HKRTFILKPDSGAQGRGIWLTNDLK--------TIGPHERLICQTYIHRPL 294
                     |:|: ::..:|:||.:..:||||.|.::||        :|....|.:.|.||.|||
  Fly   409 ---------YSLDGYQNMWIVKPANKCRGRGIILMDNLKKILGVVNLSIASKSRYVVQKYIERPL 464

  Fly   295 LIDGYKFDLRVYTLITSVDPLRIFVYNEGLARFATNKYVEPTPGNANDLYMHLTNYSVNKRNSHY 359
            ::...|||:|.:.|||:..||.::.|.|...||::.:|   :..|.:: .:|||||::.|:.:: 
  Fly   465 ILFQTKFDIRQWFLITNTQPLVVWFYRESYLRFSSQEY---SLSNHHE-SVHLTNYAIQKKYTN- 524

  Fly   360 ELCDNDDCGSK-RKLSAINNW-----------MRRHNYDVEEFWSNVDDVIIKTVLSAWPVLKHN 412
                    |.: ::|.:.|.|           :.::|..:|..:..:...|:..:|::    :.|
  Fly   525 --------GKRDKRLPSENMWDCYSFQAYLRQIGKYNMWLERIFPGMRKAIVGCMLAS----QEN 577

  Fly   413 YHACFPGHDKIQACFEILGFDILVDWKLKPYILEVNHSPSFHTNEQVDREVKRPLIRDTLNLVST 477
            .       |:....||:.|.|.::.....|:::|:|.||.......|...:....:.|.:.:|..
  Fly   578 M-------DRRPNTFELFGADFMICENFYPWLIEINSSPDLGATTSVTARMCPQCLEDVVKVVID 635

  Fly   478 VLADKRQILKEDRKRVKQRL----------LKIRGDPPVQRPRLGGG 514
            ...|.:..|.......:|.:          |.::|...:|:...|||
  Fly   636 RRTDPKAELGNFELAYRQVVPPTPAYMGLNLFVKGKQVLQKANHGGG 682

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TTLL6BNP_651549.1 TTL 196..486 CDD:281171 74/314 (24%)
TTLL3ANP_609069.1 TTL 342..640 CDD:281171 80/347 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450547
Domainoid 1 1.000 75 1.000 Domainoid score I2480
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.