DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TTLL6B and TTLL3B

DIOPT Version :9

Sequence 1:NP_651549.1 Gene:TTLL6B / 43282 FlyBaseID:FBgn0039501 Length:720 Species:Drosophila melanogaster
Sequence 2:NP_609068.2 Gene:TTLL3B / 33946 FlyBaseID:FBgn0031853 Length:756 Species:Drosophila melanogaster


Alignment Length:507 Identity:111/507 - (21%)
Similarity:178/507 - (35%) Gaps:181/507 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 VDEERPAS--ETKSTICVSNSRYAMIGKISKTL----GYKL----VKESKMWNILWSDSF--PGV 187
            |.|.:||.  ....||..:...:| :||:.|.:    .|.|    :|......|:.:.:|  ...
  Fly   294 VREHQPAELISENGTIFSTTLDFA-LGKVKKMVRHAEHYSLDDARIKPPTPAEIVENQTFMVQST 357

  Fly   188 ELFKNMKRFQQINHFPGMIEICRKDLLSRNLNRMLKIFPQDYKIFPKTWMLPADYGDAMNYALNH 252
            ::.|:..:|:.....  |.|..|  |....|:::..:.| ||:     |.             ..
  Fly   358 DVLKSNAKFKVSEKV--MAEYAR--LAGLYLDQIESLRP-DYR-----WD-------------GS 399

  Fly   253 KRTFILKPDSGAQGRGI-------------WLTNDLKTIGPHERLICQTYIHRPLLIDGYKFDLR 304
            :..:||||  |.|.|||             |.:|:     .:::.|.|.||.|||||...|||:|
  Fly   400 RNLWILKP--GYQSRGIGIVIRSSLDDILQWTSNN-----QNKKYIVQKYIERPLLIYRTKFDIR 457

  Fly   305 VYTLITSVD-PLRIFVYNEGLARFATNKYVEPTPGNANDL--YMHLTNYSVNKRNSHYELCDNDD 366
            .|.|:|..| .:.|:.|.:...||::.::      ..:||  .:||||.||.||   |:...|.|
  Fly   458 QYMLLTITDTKVSIWTYRDCYLRFSSQEF------TMDDLRESIHLTNNSVQKR---YKNKTNRD 513

  Fly   367 CGSKRKLSAINNWMRRHNYDVEEF-------------WSNVDDVIIKTVLSAWPVLKHNYHACFP 418
                .:|...|.|      .:::|             ||...:...:.:::.       ..|...
  Fly   514 ----SRLPKNNMW------SLDQFKNYLRIMGAPDGSWSKTYNGFKQNLVAV-------VMASLD 561

  Fly   419 GHDKIQACFEILGFDILVDWKLKPYILEVNHSPSFHTNEQVDREV----------------KRP- 466
            ..:.:|..||:.|.|.::|....|.::|:|.:|....:.::...:                |.| 
  Fly   562 ETELLQNAFELYGCDFMLDEHYNPILIEINSTPDLSPSTEITARICPMVLKDCIRVVVDLPKNPT 626

  Fly   467 ------------------------------------------------LIRDTLNLVSTVLADK- 482
                                                            |:|..||.|.|....| 
  Fly   627 AATGLFELAFEVNYSINKGADGKPLELNGKQMTLFENMPRMRNSPRTRLLRKILNNVKTSTTKKV 691

  Fly   483 RQILKEDRKRVKQRLLKIRGDPPVQRPRLGGGTSKPKIDAQKGS---PDAQP 531
            .::::...|.||....||              |.|.|:.|..||   ..|||
  Fly   692 EKVVEAPAKNVKNPTAKI--------------TKKKKLSASAGSSTAASAQP 729

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TTLL6BNP_651549.1 TTL 196..486 CDD:281171 81/384 (21%)
TTLL3BNP_609068.2 TTL 325..626 CDD:281171 79/356 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450548
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.