DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TTLL6B and Ttll1

DIOPT Version :9

Sequence 1:NP_651549.1 Gene:TTLL6B / 43282 FlyBaseID:FBgn0039501 Length:720 Species:Drosophila melanogaster
Sequence 2:NP_001344882.1 Gene:Ttll1 / 319953 MGIID:2443047 Length:423 Species:Mus musculus


Alignment Length:351 Identity:110/351 - (31%)
Similarity:173/351 - (49%) Gaps:62/351 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 GYKLVKESKMWNILWSDSFPGVELFKN---------MKRFQQINHFPGMIEICRKDLLSRNLNRM 221
            |:..|.|::.||..|.    .|:..:|         :...|.:||||...|:.||||:.:|:.|.
Mouse    24 GWIQVTENEDWNFYWM----SVQTIRNVFSVETGYRLSDDQIVNHFPNHYELTRKDLMVKNIKRY 84

  Fly   222 LKIFPQD--------------YKIF-PKTWMLPADYG-DAMNYALNHKRTFILKPDSGAQGRGIW 270
            .|...::              |..| |.|:||||||. ....:..:...|:|:||...|||:||:
Mouse    85 RKELEKEGSPLAEKDENGKYLYLDFVPVTYMLPADYNLFVEEFRKSPSSTWIMKPCGKAQGKGIF 149

  Fly   271 LTNDLKTI---------------GPHERLICQTYIHRPLLIDGYKFDLRVYTLITSVDPLRIFVY 320
            |.|.|..|               ...|..:...||:.||||.|.|||||:|.|:::..|||.::|
Mouse   150 LINKLSQIKKWSRDSKTSSFVSQSTKEAYVISVYINNPLLIGGRKFDLRLYVLVSTYRPLRCYMY 214

  Fly   321 NEGLARFATNKYVEPTPGNANDLYMHLTNYSVNKRNSHYELCDNDDCGSKRKLSAINNWMR--RH 383
            ..|..||.|.||. |:....:::::||||.::.|....|    |...|.|..::.:..::.  |.
Mouse   215 KLGFCRFCTVKYT-PSTSELDNMFVHLTNVAIQKHGEDY----NHIHGGKWTVNNLRLYLESTRG 274

  Fly   384 NYDVEEFWSNVDDVIIKTVLSAWPVLKHNYHACFPGHDKIQACFEILGFDILVDWKLKPYILEVN 448
            .....:.:..:..:|::::.:..||:.::.|           |||..|:||::|.||||:::|||
Mouse   275 REVTSKLFDEIHWIIVQSLKAVAPVMNNDKH-----------CFECYGYDIIIDDKLKPWLIEVN 328

  Fly   449 HSPSFHTNEQVDREVKRPLIRDTLNL 474
            .|||..::...||.:|..||.||||:
Mouse   329 ASPSLTSSTANDRILKYNLINDTLNI 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TTLL6BNP_651549.1 TTL 196..486 CDD:281171 102/312 (33%)
Ttll1NP_001344882.1 TTL 59..364 CDD:281171 102/312 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 390..423
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.