DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TTLL6B and TTLL9

DIOPT Version :9

Sequence 1:NP_651549.1 Gene:TTLL6B / 43282 FlyBaseID:FBgn0039501 Length:720 Species:Drosophila melanogaster
Sequence 2:NP_001008409.1 Gene:TTLL9 / 164395 HGNCID:16118 Length:439 Species:Homo sapiens


Alignment Length:466 Identity:131/466 - (28%)
Similarity:201/466 - (43%) Gaps:105/466 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 MPAEEAKLQGFIQLNNKTYRVECPTRVLNPPMNVD----------EERPASETKSTICVSNSRYA 156
            :|:.||      .|...|..:.||.::.|  .|..          |:|.:...|:|:     ...
Human     2 VPSREA------LLGPGTTAIRCPKKLQN--QNYKGHGLSKGKEREQRASIRFKTTL-----MNT 53

  Fly   157 MIGKISKTLGYKLVKESKMWNILWSDSFPGVELFKN--MKRFQQINHFPGMIEICRKDLLSRNLN 219
            ::..:....|:..||:...|:..|.|.....|.|.:  |....:|:||....|:.||:.:.:||.
Human    54 LMDVLRHRPGWVEVKDEGEWDFYWCDVSWLRENFDHTYMDEHVRISHFRNHYELTRKNYMVKNLK 118

  Fly   220 RMLKIFPQD--------YKIFPKTWMLPADYG-DAMNYALNHKRTFILKPDSGAQGRGIWLTNDL 275
            |..|...::        ...||||:.:|.:|. ....:..|...|:|:||.:.:||:||:|...|
Human   119 RFRKQLEREAGKLEAAKCDFFPKTFEMPCEYHLFVEEFRKNPGITWIMKPVARSQGKGIFLFRRL 183

  Fly   276 KTIG----------------PHERLICQTYIHRPLLIDGYKFDLRVYTLITSVDPLRIFVYNEGL 324
            |.|.                |.|..:.|.||..|.||.|.|||||||.|:.|       |:.|.|
Human   184 KDIVDWRKDTRSSDDQKDDIPVENYVAQRYIENPYLIGGRKFDLRVYVLVMS-------VFAECL 241

  Fly   325 ARFATNKYVEPTPGNANDLYMHLTNYSVNKRNSHYELCDNDDCGSKRKLSAINNWM-RRHNYD-V 387
            ......:         .|  :||||.:|.|.:..|    :...|.|..|.....:: .:|..: |
Human   242 LWSGHRR---------QD--VHLTNVAVQKTSPDY----HPKKGCKWTLQRFRQYLASKHGPEAV 291

  Fly   388 EEFWSNVDDVIIKTVLSAWPVLKHNYHACFPGHDKIQACFEILGFDILVDWKLKPYILEVNHSPS 452
            |..:.::|::.:|::.|...|:..:.|           |||:.|:|||:|..|||::||||.|||
Human   292 ETLFRDIDNIFVKSLQSVQKVIISDKH-----------CFELYGYDILIDQDLKPWLLEVNASPS 345

  Fly   453 FHTNEQVDREVKRPLIRDTLNLVSTVLADKRQILKEDRKRVKQRLLKIRGDPPVQRPRLGGGTSK 517
            ...:.|.|.|:|..|:.|||::|     |....|....|||....| :..|.||.|         
Human   346 LTASSQEDYELKTCLLEDTLHVV-----DMEARLTGREKRVGGFDL-MWNDGPVSR--------- 395

  Fly   518 PKIDAQKGSPD 528
                 ::|:||
Human   396 -----EEGAPD 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TTLL6BNP_651549.1 TTL 196..486 CDD:281171 97/316 (31%)
TTLL9NP_001008409.1 TTL 92..368 CDD:281171 96/308 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.