DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5984 and jbug

DIOPT Version :9

Sequence 1:NP_651548.1 Gene:CG5984 / 43281 FlyBaseID:FBgn0039500 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001261140.1 Gene:jbug / 43997 FlyBaseID:FBgn0028371 Length:2990 Species:Drosophila melanogaster


Alignment Length:266 Identity:61/266 - (22%)
Similarity:92/266 - (34%) Gaps:77/266 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 MRLNTQAASSASACSSSGSGLEGNSPEEGGIFGRYQRTPDADAYPSESPRVYVAPELTDAGKVQL 72
            :.:|...||:....|.||.||             ||.                            
  Fly  2273 LEINVLPASAGKEISVSGLGL-------------YQS---------------------------- 2296

  Fly    73 LHFPSGAVRVNSPLGFII---KRNGVKGNFEVRVEGPSGQPIQPVRQQQLDPERFQIDCQLDAGA 134
                    ||.....|.|   ||..  ..|:|.|.||.||.: |||..|......|.:..::. .
  Fly  2297 --------RVGKTTSFAIDTVKRPA--REFDVVVSGPGGQAL-PVRCYQTKNGHLQAEFTINK-P 2349

  Fly   135 GLYKVHIKCNSVTLPRSPFIIVAIAGATESIDGKPASSSVPISDSDASRVQSRGLGLTHVSLVER 199
            |...:.:...|..||.|||       ..||.              |:|:|.::|:....::|...
  Fly  2350 GQCVIEVLHQSKPLPGSPF-------TCESF--------------DSSKVSTQGVTKEPLALHSP 2393

  Fly   200 NEFTVDCGQAGSNMLLVGVLGQRGPCEEVVVRHLGRGIHRVTYRVCDPGDYILVVKWGEQHVPGS 264
            |.|||....||:..|....:........|::.....|::.|.:....||:|.|.:.:|.:.:|.|
  Fly  2394 NSFTVRTDNAGTAELEAFAISPSNQSIPVLISEQSDGVYNVEFVPSQPGNYKLTLMYGGETIPSS 2458

  Fly   265 PFSLSA 270
            |.:.:|
  Fly  2459 PLNFTA 2464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5984NP_651548.1 Filamin 65..154 CDD:279024 24/91 (26%)
Filamin 179..266 CDD:279024 22/86 (26%)
IG_FLMN 181..271 CDD:214720 23/90 (26%)
jbugNP_001261140.1 CH 60..165 CDD:237981
CH 172..269 CDD:278723
CH 281..371 CDD:278723
IG_FLMN 468..560 CDD:214720
Filamin 468..554 CDD:279024
Filamin 557..644 CDD:279024
IG_FLMN 560..648 CDD:214720
Filamin 1116..1200 CDD:279024
IG_FLMN 1119..1198 CDD:214720
Filamin 1210..1294 CDD:279024
Filamin 1299..1383 CDD:279024
IG_FLMN 1310..1389 CDD:214720
Filamin 1386..1473 CDD:279024
IG_FLMN 1399..1480 CDD:214720
Filamin 1477..1563 CDD:279024
IG_FLMN 1480..1569 CDD:214720
Filamin 1570..1653 CDD:279024
IG_FLMN 1575..1659 CDD:214720
Filamin 1657..1741 CDD:279024
IG_FLMN 1661..1747 CDD:214720
Filamin 1756..1830 CDD:279024
Filamin 1834..1919 CDD:279024
IG_FLMN 1837..1926 CDD:214720
IG_FLMN 1936..2023 CDD:214720
Filamin 1941..2017 CDD:279024
Filamin 2021..2111 CDD:279024
IG_FLMN 2025..2114 CDD:214720
Filamin 2187..2268 CDD:279024
Filamin 2279..2369 CDD:279024 34/149 (23%)
IG_FLMN 2285..2375 CDD:214720 34/163 (21%)
Filamin 2372..2459 CDD:279024 22/100 (22%)
IG_FLMN 2376..2465 CDD:214720 23/89 (26%)
IG_FLMN 2474..2561 CDD:214720
Filamin 2474..2555 CDD:279024
IG_FLMN 2657..2751 CDD:214720
Filamin 2657..2745 CDD:279024
Filamin 2755..2840 CDD:279024
IG_FLMN 2756..2847 CDD:214720
Filamin 2847..2937 CDD:279024
IG_FLMN 2850..2944 CDD:214720
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439917
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0518
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.