Sequence 1: | NP_651548.1 | Gene: | CG5984 / 43281 | FlyBaseID: | FBgn0039500 | Length: | 271 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001261140.1 | Gene: | jbug / 43997 | FlyBaseID: | FBgn0028371 | Length: | 2990 | Species: | Drosophila melanogaster |
Alignment Length: | 266 | Identity: | 61/266 - (22%) |
---|---|---|---|
Similarity: | 92/266 - (34%) | Gaps: | 77/266 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 MRLNTQAASSASACSSSGSGLEGNSPEEGGIFGRYQRTPDADAYPSESPRVYVAPELTDAGKVQL 72
Fly 73 LHFPSGAVRVNSPLGFII---KRNGVKGNFEVRVEGPSGQPIQPVRQQQLDPERFQIDCQLDAGA 134
Fly 135 GLYKVHIKCNSVTLPRSPFIIVAIAGATESIDGKPASSSVPISDSDASRVQSRGLGLTHVSLVER 199
Fly 200 NEFTVDCGQAGSNMLLVGVLGQRGPCEEVVVRHLGRGIHRVTYRVCDPGDYILVVKWGEQHVPGS 264
Fly 265 PFSLSA 270 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5984 | NP_651548.1 | Filamin | 65..154 | CDD:279024 | 24/91 (26%) |
Filamin | 179..266 | CDD:279024 | 22/86 (26%) | ||
IG_FLMN | 181..271 | CDD:214720 | 23/90 (26%) | ||
jbug | NP_001261140.1 | CH | 60..165 | CDD:237981 | |
CH | 172..269 | CDD:278723 | |||
CH | 281..371 | CDD:278723 | |||
IG_FLMN | 468..560 | CDD:214720 | |||
Filamin | 468..554 | CDD:279024 | |||
Filamin | 557..644 | CDD:279024 | |||
IG_FLMN | 560..648 | CDD:214720 | |||
Filamin | 1116..1200 | CDD:279024 | |||
IG_FLMN | 1119..1198 | CDD:214720 | |||
Filamin | 1210..1294 | CDD:279024 | |||
Filamin | 1299..1383 | CDD:279024 | |||
IG_FLMN | 1310..1389 | CDD:214720 | |||
Filamin | 1386..1473 | CDD:279024 | |||
IG_FLMN | 1399..1480 | CDD:214720 | |||
Filamin | 1477..1563 | CDD:279024 | |||
IG_FLMN | 1480..1569 | CDD:214720 | |||
Filamin | 1570..1653 | CDD:279024 | |||
IG_FLMN | 1575..1659 | CDD:214720 | |||
Filamin | 1657..1741 | CDD:279024 | |||
IG_FLMN | 1661..1747 | CDD:214720 | |||
Filamin | 1756..1830 | CDD:279024 | |||
Filamin | 1834..1919 | CDD:279024 | |||
IG_FLMN | 1837..1926 | CDD:214720 | |||
IG_FLMN | 1936..2023 | CDD:214720 | |||
Filamin | 1941..2017 | CDD:279024 | |||
Filamin | 2021..2111 | CDD:279024 | |||
IG_FLMN | 2025..2114 | CDD:214720 | |||
Filamin | 2187..2268 | CDD:279024 | |||
Filamin | 2279..2369 | CDD:279024 | 34/149 (23%) | ||
IG_FLMN | 2285..2375 | CDD:214720 | 34/163 (21%) | ||
Filamin | 2372..2459 | CDD:279024 | 22/100 (22%) | ||
IG_FLMN | 2376..2465 | CDD:214720 | 23/89 (26%) | ||
IG_FLMN | 2474..2561 | CDD:214720 | |||
Filamin | 2474..2555 | CDD:279024 | |||
IG_FLMN | 2657..2751 | CDD:214720 | |||
Filamin | 2657..2745 | CDD:279024 | |||
Filamin | 2755..2840 | CDD:279024 | |||
IG_FLMN | 2756..2847 | CDD:214720 | |||
Filamin | 2847..2937 | CDD:279024 | |||
IG_FLMN | 2850..2944 | CDD:214720 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45439917 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0518 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.830 |