DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG5984 and kst

DIOPT Version :9

Sequence 1:	NP_651548.1	Gene:	CG5984 / 43281	FlyBaseID:	FBgn0039500	Length:	271	Species:	Drosophila melanogaster
Sequence 2:	NP_001097492.2	Gene:	kst / 38418	FlyBaseID:	FBgn0004167	Length:	4337	Species:	Drosophila melanogaster

Alignment Length:	94	Identity:	23/94 - (24%)
Similarity:	35/94 - (37%)	Gaps:	11/94 - (11%)

- Green bases have known domain annotations that are detailed below.

  Fly    23 SSGSGLEGNSPEEGGIFGRYQRTPDADAYPSESPRVYVAPELTDAGKVQLLHFPSGAVRVNSP-L 86
            ||.||:.|:....|......:|.......|.::.|   .|..|...:.|       :.|.|.. .
  Fly  3738 SSSSGMFGDRLRRGSADANVKRAESMKVQPKQAKR---TPSFTTRRRAQ-------SFRKNQKGE 3792

  Fly    87 GFIIKRNGVKGNFEVRVEGPSGQPIQPVR 115
            ||.:....::|:.|.:....||....|||
  Fly  3793 GFDLPPVEIQGSLERKHGLQSGGKKAPVR 3821

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG5984	NP_651548.1	Filamin	65..154	CDD:279024	13/52 (25%)
		Filamin	179..266	CDD:279024
		IG_FLMN	181..271	CDD:214720
kst	NP_001097492.2	CH	76..178	CDD:237981
		CH	197..303	CDD:237981
		SPEC	450..640	CDD:238103
		SPEC	658..832	CDD:238103
		SH3	885..935	CDD:214620
		SPEC	1030..1236	CDD:238103
		SPEC	1134..1341	CDD:238103
		SPEC	1343..1551	CDD:238103
		SPEC	1449..1658	CDD:238103
		SPEC	1555..1764	CDD:238103
		SPEC	1765..1975	CDD:238103
		SPEC	1873..2080	CDD:238103
		SPEC	1979..2185	CDD:238103
		SPEC	2188..2402	CDD:238103
		SPEC	2407..2618	CDD:238103
		SPEC	2514..2725	CDD:238103
		SPEC	2726..2934	CDD:238103
		SPEC	2935..3145	CDD:238103
		SPEC	3042..3251	CDD:238103
		SPEC	3149..3357	CDD:238103
		SPEC	3359..3567	CDD:238103
		SPEC	3465..3680	CDD:238103
		PH	3799..3902	CDD:278594	7/23 (30%)
		PH_beta_spectrin	3801..3904	CDD:269975	7/21 (33%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C45439915
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	0.930