Sequence 1: | NP_651548.1 | Gene: | CG5984 / 43281 | FlyBaseID: | FBgn0039500 | Length: | 271 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_725339.1 | Gene: | shot / 36542 | FlyBaseID: | FBgn0013733 | Length: | 8805 | Species: | Drosophila melanogaster |
Alignment Length: | 195 | Identity: | 44/195 - (22%) |
---|---|---|---|
Similarity: | 56/195 - (28%) | Gaps: | 71/195 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 16 SSASACSSSGSGLEGNSPEEGGIFGRYQRTPDADAYPSESPRVYVAPELTDAGKVQLLHFPSGAV 80
Fly 81 RVNSPLGFIIKRNGVKGNFEVRVEGPSGQPIQPVRQQQLDPERFQIDCQLD-------------- 131
Fly 132 -------AGAGLYKVHIKCNSVTLPRSPFIIVAIAGATESIDGKPASSS---VPISDSDASRVQS 186
Fly 187 186 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5984 | NP_651548.1 | Filamin | 65..154 | CDD:279024 | 19/109 (17%) |
Filamin | 179..266 | CDD:279024 | 3/8 (38%) | ||
IG_FLMN | 181..271 | CDD:214720 | 3/6 (50%) | ||
shot | NP_725339.1 | SAC6 | 204..>420 | CDD:227401 | |
CH | 223..327 | CDD:306753 | |||
SPEC | 471..689 | CDD:238103 | |||
SPEC | 690..866 | CDD:238103 | |||
SH3 | 885..922 | CDD:327375 | |||
SPEC | 1047..1250 | CDD:238103 | |||
SPEC | 1153..1390 | CDD:238103 | |||
PLEC | <1498..1526 | CDD:197605 | |||
Plectin | 1949..1981 | CDD:307019 | |||
DNA_pol3_delta2 | <2711..3178 | CDD:331068 | |||
DUF4775 | 3026..3357 | CDD:330579 | |||
SMC_N | <4904..5566 | CDD:330553 | |||
SPEC | 5304..5513 | CDD:238103 | |||
SPEC | <5658..5787 | CDD:321951 | |||
SPEC | 5793..6007 | CDD:238103 | |||
SPEC | 6011..6220 | CDD:238103 | |||
SPEC | 6118..6330 | CDD:238103 | |||
PRK09039 | <6279..6441 | CDD:332967 | |||
SPEC | 6443..6660 | CDD:238103 | |||
SPEC | 6663..6878 | CDD:238103 | |||
SPEC | 6880..7087 | CDD:238103 | |||
SPEC | 6986..7196 | CDD:238103 | |||
SPEC | 7196..7417 | CDD:238103 | |||
SPEC | 7314..7526 | CDD:238103 | |||
SPEC | 7528..7747 | CDD:238103 | |||
SPEC | 7749..7968 | CDD:238103 | |||
SPEC | 7973..8181 | CDD:238103 | |||
EF-hand_7 | 8373..8437 | CDD:316058 | |||
GAS2 | 8450..8522 | CDD:128539 | |||
Herpes_ICP4_C | 8550..>8795 | CDD:332854 | 44/195 (23%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45439914 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |