DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5984 and Dyb

DIOPT Version :9

Sequence 1:NP_651548.1 Gene:CG5984 / 43281 FlyBaseID:FBgn0039500 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001097287.1 Gene:Dyb / 36362 FlyBaseID:FBgn0033739 Length:816 Species:Drosophila melanogaster


Alignment Length:241 Identity:52/241 - (21%)
Similarity:80/241 - (33%) Gaps:70/241 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 FKVSQEMRLNTQAASSASACSSSGSGLEGNSPEEGGIFGRYQRTPDA----DAYPS------ESP 56
            |..||..:||..::...||.:::||.    :|..       .||..|    .|.||      ::|
  Fly   585 FSQSQLEQLNQISSDMRSAFAANGSA----TPPP-------MRTTTATANVSAIPSLNPISNQNP 638

  Fly    57 RVYVAPELTDAGKVQLLHFPSGAVRVNSPLGFIIKRNGVKGNFEVRVEGPSGQPIQPVRQQQ-LD 120
            .:....||.:|..    |..|....:.|.|      |..:|    |.:....||...:.|.: :.
  Fly   639 NLNPDAELNEAAD----HLTSAISHMVSDL------NAGRG----RAQQLGPQPASSIPQARFIM 689

  Fly   121 PERF------------QIDCQLDAGAGLYK------VHIKCNSVTLP-RSPFIIVAIAGATESID 166
            |..|            |.:|. |...|.|:      ..::|.....| .:.:.:...:|..|.  
  Fly   690 PLEFRHIEGGESEDSSQCECN-DCECGEYEEVFRTDEDLECEGAAAPFGNAYSLFPTSGVHEE-- 751

  Fly   167 GKPASSSVPISDSDASRVQSRGLGLTHVSLVERN--EFTVDCGQAG 210
                      ...|.:..|...|...:..|..||  |..:|..|||
  Fly   752 ----------DHFDYTFGQGEELSQVNRILGYRNHPELFIDDEQAG 787

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5984NP_651548.1 Filamin 65..154 CDD:279024 20/108 (19%)
Filamin 179..266 CDD:279024 11/34 (32%)
IG_FLMN 181..271 CDD:214720 10/32 (31%)
DybNP_001097287.1 EF-hand_2 7..131 CDD:286194
EF-hand_3 135..223 CDD:286195
ZZ_dystrophin 232..280 CDD:239074
Ribosomal_L29 436..482 CDD:279204
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439894
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.