Sequence 1: | NP_651548.1 | Gene: | CG5984 / 43281 | FlyBaseID: | FBgn0039500 | Length: | 271 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_038963702.1 | Gene: | Flnc / 362332 | RGDID: | 1308807 | Length: | 2747 | Species: | Rattus norvegicus |
Alignment Length: | 337 | Identity: | 88/337 - (26%) |
---|---|---|---|
Similarity: | 137/337 - (40%) | Gaps: | 118/337 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 49 DAYPSESPRVYVAPELT-DAGKVQLLHFPSGAVRVNSPLGFIIKRNGVKGNFEVRVEGPSGQPIQ 112
Fly 113 PVRQQQLDPERFQIDCQLDAGAGLYKVHIKCNSVTLPRSPF------------------------ 153
Fly 154 ------------------------------------------------------IIVAIA-GATE 163
Fly 164 SIDGKP------------------------------------ASSSVPISDSDASRVQSRGLGLT 192
Fly 193 HVSLVERNEFTVDCGQAGSNMLLVGVLGQRGPCEEVVVRHLGRGIHRVTYRVCDPGDYILVVKWG 257
Fly 258 EQHVPGSPFSLS 269 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5984 | NP_651548.1 | Filamin | 65..154 | CDD:279024 | 24/167 (14%) |
Filamin | 179..266 | CDD:279024 | 48/86 (56%) | ||
IG_FLMN | 181..271 | CDD:214720 | 48/89 (54%) | ||
Flnc | XP_038963702.1 | CH_FLNC_rpt1 | 23..147 | CDD:409159 | |
CH_FLNC_rpt2 | 151..265 | CDD:409163 | |||
IG_FLMN | 276..372 | CDD:214720 | |||
IG_FLMN | 376..471 | CDD:214720 | |||
IG_FLMN | 496..589 | CDD:214720 | |||
IG_FLMN | 593..683 | CDD:214720 | |||
IG_FLMN | 689..783 | CDD:214720 | |||
IG_FLMN | 786..886 | CDD:214720 | |||
IG_FLMN | 889..985 | CDD:214720 | |||
IG_FLMN | 989..1082 | CDD:214720 | |||
IG_FLMN | 1084..1173 | CDD:214720 | |||
IG_FLMN | 1177..1269 | CDD:214720 | |||
IG_FLMN | 1273..1369 | CDD:214720 | |||
IG_FLMN | 1372..1461 | CDD:214720 | |||
IG_FLMN | 1465..1558 | CDD:214720 | |||
IG_FLMN | 1561..1655 | CDD:214720 | |||
IG_FLMN | 1658..1754 | CDD:214720 | |||
IG_FLMN | <1813..1877 | CDD:214720 | |||
IG_FLMN | 1884..1970 | CDD:214720 | |||
IG_FLMN | 2063..2152 | CDD:214720 | |||
IG_FLMN | <2266..2330 | CDD:214720 | |||
IG_FLMN | 2336..2424 | CDD:214720 | 4/12 (33%) | ||
Filamin | 2429..2515 | CDD:395505 | 23/87 (26%) | ||
IG_FLMN | 2527..2617 | CDD:214720 | 6/89 (7%) | ||
IG_FLMN | 2657..2746 | CDD:214720 | 48/89 (54%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0518 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |