powered by:
Protein Alignment CG5984 and beta-Spec
DIOPT Version :9
Sequence 1: | NP_651548.1 |
Gene: | CG5984 / 43281 |
FlyBaseID: | FBgn0039500 |
Length: | 271 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001259660.1 |
Gene: | beta-Spec / 32746 |
FlyBaseID: | FBgn0250788 |
Length: | 2308 |
Species: | Drosophila melanogaster |
Alignment Length: | 67 |
Identity: | 14/67 - (20%) |
Similarity: | 32/67 - (47%) |
Gaps: | 15/67 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 89 IIKRNGVKGNFEVRVEGPSGQPIQPVRQQQ--------LDPERFQIDCQL------DAGAGLYKV 139
::|:..|...|| :::.|..:..:.:.::: ::.|:..||.:| |.|..|:.|
Fly 1459 VVKKTAVLERFE-KIKAPLLERQKALEKKKEAFQFCRDVEDEKLWIDEKLPVANSPDYGNSLFNV 1522
Fly 140 HI 141
|:
Fly 1523 HV 1524
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45439901 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.