DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5984 and beta-Spec

DIOPT Version :9

Sequence 1:NP_651548.1 Gene:CG5984 / 43281 FlyBaseID:FBgn0039500 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001259660.1 Gene:beta-Spec / 32746 FlyBaseID:FBgn0250788 Length:2308 Species:Drosophila melanogaster


Alignment Length:67 Identity:14/67 - (20%)
Similarity:32/67 - (47%) Gaps:15/67 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 IIKRNGVKGNFEVRVEGPSGQPIQPVRQQQ--------LDPERFQIDCQL------DAGAGLYKV 139
            ::|:..|...|| :::.|..:..:.:.:::        ::.|:..||.:|      |.|..|:.|
  Fly  1459 VVKKTAVLERFE-KIKAPLLERQKALEKKKEAFQFCRDVEDEKLWIDEKLPVANSPDYGNSLFNV 1522

  Fly   140 HI 141
            |:
  Fly  1523 HV 1524

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5984NP_651548.1 Filamin 65..154 CDD:279024 14/67 (21%)
Filamin 179..266 CDD:279024
IG_FLMN 181..271 CDD:214720
beta-SpecNP_001259660.1 CH 51..149 CDD:278723
CH 170..269 CDD:278723
Spectrin 298..408 CDD:278843
SPEC 422..521 CDD:197544
SPEC 525..740 CDD:238103
SPEC 639..846 CDD:238103
SPEC 848..1058 CDD:238103
SPEC 955..1169 CDD:238103
SPEC 1170..1380 CDD:238103
SPEC 1386..1484 CDD:197544 5/25 (20%)
SPEC 1488..1699 CDD:238103 9/37 (24%)
SPEC 1594..1806 CDD:238103
SPEC 1807..2015 CDD:238103
Spectrin 2018..>2078 CDD:278843
PH 2167..2275 CDD:278594
PH_beta_spectrin 2167..2274 CDD:269975
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439901
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.