DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5984 and beta-Spec

DIOPT Version :10

Sequence 1:NP_651548.1 Gene:CG5984 / 43281 FlyBaseID:FBgn0039500 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001259660.1 Gene:beta-Spec / 32746 FlyBaseID:FBgn0250788 Length:2308 Species:Drosophila melanogaster


Alignment Length:67 Identity:14/67 - (20%)
Similarity:32/67 - (47%) Gaps:15/67 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 IIKRNGVKGNFEVRVEGPSGQPIQPVRQQQ--------LDPERFQIDCQL------DAGAGLYKV 139
            ::|:..|...|| :::.|..:..:.:.:::        ::.|:..||.:|      |.|..|:.|
  Fly  1459 VVKKTAVLERFE-KIKAPLLERQKALEKKKEAFQFCRDVEDEKLWIDEKLPVANSPDYGNSLFNV 1522

  Fly   140 HI 141
            |:
  Fly  1523 HV 1524

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5984NP_651548.1 Filamin 65..154 CDD:395505 14/67 (21%)
IG_FLMN 181..271 CDD:214720
beta-SpecNP_001259660.1 CH_SPTB-like_rpt1 36..152 CDD:409095
CH_SPTB_like_rpt2 169..273 CDD:409097
Spectrin 298..408 CDD:395348
SPEC 422..521 CDD:197544
SPEC 525..740 CDD:238103
SPEC 639..846 CDD:238103
SPEC 848..1058 CDD:238103
SPEC 955..1169 CDD:238103
SPEC 1170..1380 CDD:238103
SPEC 1386..1484 CDD:197544 5/25 (20%)
SPEC 1488..1699 CDD:238103 9/37 (24%)
SPEC 1594..1806 CDD:238103
SPEC 1807..2015 CDD:238103
Spectrin 2018..>2078 CDD:395348
PH_beta_spectrin 2167..2274 CDD:269975
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.