DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5984 and Actn

DIOPT Version :9

Sequence 1:NP_651548.1 Gene:CG5984 / 43281 FlyBaseID:FBgn0039500 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001259165.1 Gene:Actn / 31166 FlyBaseID:FBgn0000667 Length:917 Species:Drosophila melanogaster


Alignment Length:214 Identity:41/214 - (19%)
Similarity:72/214 - (33%) Gaps:79/214 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 RNGVKGNFEVRVEGPSGQPI-QPVRQQQLDPERFQIDCQLD--AGAGLYKVHIKCNSVTLPRSPF 153
            |||:|  ..:.:|..||:.: :|.|.:....:...::..||  |..|::.|.|            
  Fly    63 RNGLK--LMLLLEVISGETLPKPDRGKMRFHKIANVNKALDFIASKGVHLVSI------------ 113

  Fly   154 IIVAIAGATESIDG--------------KPASSSVPISDSDAS-----------------RVQSR 187
                  ||.|.:||              :.|...:.:.:..|.                 .||:.
  Fly   114 ------GAEEIVDGNLKMTLGMIWTIIL
RFAIQDISVEEMTAKEGLLLWCQRKTAPYKNVNVQNF 172

  Fly   188 GL----GLTHVSLVERNEFTVDCGQAGSNMLLVGVLGQRGPCE------EVVVRHLGRGIHRVTY 242
            .|    ||...:|:.|:.         .:::....|.:..|.|      :|..::|.      ..
  Fly   173 HLSFKDGLAFCALIHRHR---------PDLIDYAKLSKDNPLENLNTAFDVAEKYLD------IP 222

  Fly   243 RVCDPGDYILVVKWGEQHV 261
            |:.||.|.|...|..|:.:
  Fly   223 RMLDPDDLINTPKPDERAI 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5984NP_651548.1 Filamin 65..154 CDD:279024 15/64 (23%)
Filamin 179..266 CDD:279024 20/110 (18%)
IG_FLMN 181..271 CDD:214720 20/108 (19%)
ActnNP_001259165.1 CH_ACTN_rpt1 31..135 CDD:409063 20/91 (22%)
CH_ACTN_rpt2 139..252 CDD:409065 20/118 (17%)
SPEC 302..525 CDD:238103
SPEC 420..647 CDD:238103
SPEC 538..760 CDD:238103
EFh 775..842 CDD:238008
EFhand_Ca_insen 847..913 CDD:400872
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439907
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.