Sequence 1: | NP_651548.1 | Gene: | CG5984 / 43281 | FlyBaseID: | FBgn0039500 | Length: | 271 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001259165.1 | Gene: | Actn / 31166 | FlyBaseID: | FBgn0000667 | Length: | 917 | Species: | Drosophila melanogaster |
Alignment Length: | 214 | Identity: | 41/214 - (19%) |
---|---|---|---|
Similarity: | 72/214 - (33%) | Gaps: | 79/214 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 92 RNGVKGNFEVRVEGPSGQPI-QPVRQQQLDPERFQIDCQLD--AGAGLYKVHIKCNSVTLPRSPF 153
Fly 154 IIVAIAGATESIDG--------------KPASSSVPISDSDAS-----------------RVQSR 187
Fly 188 GL----GLTHVSLVERNEFTVDCGQAGSNMLLVGVLGQRGPCE------EVVVRHLGRGIHRVTY 242
Fly 243 RVCDPGDYILVVKWGEQHV 261 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5984 | NP_651548.1 | Filamin | 65..154 | CDD:279024 | 15/64 (23%) |
Filamin | 179..266 | CDD:279024 | 20/110 (18%) | ||
IG_FLMN | 181..271 | CDD:214720 | 20/108 (19%) | ||
Actn | NP_001259165.1 | CH_ACTN_rpt1 | 31..135 | CDD:409063 | 20/91 (22%) |
CH_ACTN_rpt2 | 139..252 | CDD:409065 | 20/118 (17%) | ||
SPEC | 302..525 | CDD:238103 | |||
SPEC | 420..647 | CDD:238103 | |||
SPEC | 538..760 | CDD:238103 | |||
EFh | 775..842 | CDD:238008 | |||
EFhand_Ca_insen | 847..913 | CDD:400872 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45439907 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |