Sequence 1: | NP_651548.1 | Gene: | CG5984 / 43281 | FlyBaseID: | FBgn0039500 | Length: | 271 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001157789.1 | Gene: | FLNB / 2317 | HGNCID: | 3755 | Length: | 2633 | Species: | Homo sapiens |
Alignment Length: | 336 | Identity: | 89/336 - (26%) |
---|---|---|---|
Similarity: | 137/336 - (40%) | Gaps: | 118/336 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 49 DAYPSESPRVYVAPELT---DAGKVQLLHFPSGAVRVNSPLGFIIKRNGVKGNFEVRVEGPSGQP 110
Fly 111 IQPVRQQQLDPERF------------QIDCQLDA---------------------------GAGL 136
Fly 137 ------------------------------YKVHIKCNS-------VTLPRSP--FIIVAIAGAT 162
Fly 163 ESIDGKP----------------------------------ASSSVPISDSDASRVQSRGLGLTH 193
Fly 194 VSLVERNEFTVDCGQAGSNMLLVGVLGQRGPCEEVVVRHLGRGIHRVTYRVCDPGDYILVVKWGE 258
Fly 259 QHVPGSPFSLS 269 |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165160135 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0518 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.740 |