DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5984 and Flna

DIOPT Version :9

Sequence 1:NP_651548.1 Gene:CG5984 / 43281 FlyBaseID:FBgn0039500 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_006527974.1 Gene:Flna / 192176 MGIID:95556 Length:2647 Species:Mus musculus


Alignment Length:404 Identity:94/404 - (23%)
Similarity:150/404 - (37%) Gaps:160/404 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SSGSGLEG---NSPEEGGIFGR--------------------YQRTPDAD---AYPSESPRVY-- 59
            :.|.|||.   ..|.|.||:.|                    ::...|..   ||..:.|..|  
Mouse  2243 AGGPGLERAEVGVPAEFGIWTREAGAGGLAIAVEGPSKAEISFEDRKDGSCGVAYVVQEPGDYEV 2307

  Fly    60 -----------------VAPELTDAGKVQLLHFPSGAVRVNSPLGFIIKRNGVKGNFEVRVEGPS 107
                             ||....||.::.:.......::||.|..|.:..||.||..:.:|..||
Mouse  2308 SVKFNEEHIPDSPFVVPVASPSGDARRLTVSSLQESGLKVNQPASFAVSLNGAKGAIDAKVHSPS 2372

  Fly   108 GQPIQPVRQQQLDPERFQIDCQLDAGAGLYKVHIKCNSVTLPRSPF--------------IIVAI 158
            | .::.....::|.:::.:.. :....|:|.:.:|.|...:|.|||              ::.|.
Mouse  2373 G-ALEECYVTEIDQDKYAVRF-IPRENGIYLIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAY 2435

  Fly   159 -AGATESIDGKPA---------------------------------------------------- 170
             ||....:.|.||                                                    
Mouse  2436 GAGLEGGVTGSPAEFIVNTSNAGAGALSVTIDGPSKVKMDCQECPEGYRVTYTPMAPGSYLISIK 2500

  Fly   171 -----------------------------SSSVPISD-----------------SDASRVQSRGL 189
                                         :|||.:..                 :|.|:|.::||
Mouse  2501 YGGPYHIGGSPFKAKVTGPRLVSNHSLHETSSVFVDSLTKVATVPQHATSGPGPADVSKVVAKGL 2565

  Fly   190 GLTHVSLVERNEFTVDCGQAGSNMLLVGVLGQRGPCEEVVVRHLGRGIHRVTYRVCDPGDYILVV 254
            ||:...:.:::.|||||.:||:|||||||.|.|.||||::|:|:|..::.|:|.:.|.|:|.|||
Mouse  2566 GLSKAYVGQKSNFTVDCSKAGNNMLLVGVHGPRTPCEEILVKHMGSRLYSVSYLLKDKGEYTLVV 2630

  Fly   255 KWGEQHVPGSPFSL 268
            |||::|:||||:.:
Mouse  2631 KWGDEHIPGSPYRI 2644

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5984NP_651548.1 Filamin 65..154 CDD:279024 23/102 (23%)
Filamin 179..266 CDD:279024 45/86 (52%)
IG_FLMN 181..271 CDD:214720 45/88 (51%)
FlnaXP_006527974.1 CH_FLNA_rpt1 25..153 CDD:409157
CH_FLNA_rpt2 156..269 CDD:409161
IG_FLMN 281..375 CDD:214720
IG_FLMN 381..477 CDD:214720
IG_FLMN 480..571 CDD:214720
IG_FLMN 577..659 CDD:214720
IG_FLMN 672..766 CDD:214720
IG_FLMN 769..869 CDD:214720
IG_FLMN 872..968 CDD:214720
IG_FLMN 972..1064 CDD:214720
IG_FLMN 1067..1156 CDD:214720
IG_FLMN 1160..1252 CDD:214720
IG_FLMN 1256..1352 CDD:214720
IG_FLMN 1355..1442 CDD:214720
IG_FLMN 1448..1542 CDD:214720
IG_FLMN 1545..1639 CDD:214720
IG_FLMN 1665..1743 CDD:214720
IG_FLMN <1797..1861 CDD:214720
IG_FLMN 1868..1954 CDD:214720
IG_FLMN 2047..2136 CDD:214720
IG_FLMN 2238..2328 CDD:214720 16/84 (19%)
IG_FLMN 2332..2423 CDD:214720 22/92 (24%)
IG_FLMN 2429..2519 CDD:214720 6/89 (7%)
IG_FLMN 2558..2646 CDD:214720 45/87 (52%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0518
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.