DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5984 and fln-2

DIOPT Version :9

Sequence 1:NP_651548.1 Gene:CG5984 / 43281 FlyBaseID:FBgn0039500 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001359882.1 Gene:fln-2 / 181168 WormBaseID:WBGene00016006 Length:3611 Species:Caenorhabditis elegans


Alignment Length:356 Identity:68/356 - (19%)
Similarity:102/356 - (28%) Gaps:163/356 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 YP-------SESPRVYVAPELTDAGKVQLLHFPSGAVRVNSPLGFIIKRNGVKGNFEVRVEGPSG 108
            ||       .|.|.||.|.             ...::::..|...|.......|..::...||.|
 Worm  3018 YPQTILVSEQEKPAVYGAA-------------VDQSIKIGEPASLIFDPKKTNGGLKIHATGPDG 3069

  Fly   109 QPI------QP--VRQQQLDPERFQIDCQLDAGAGLYKVHIKCNSVTLPRSPFIIVAI------- 158
            |.:      :|  ..:....||.          .|.|.|.|..|:..:..|||.:..:       
 Worm  3070 QKVHHNVMRRPNGTSEVVFYPEE----------TGTYNVSIDFNNRPITGSPFTVNVVDPTKVIV 3124

  Fly   159 --------------AGATESID------------------------------------------- 166
                          .|.:.|.|                                           
 Worm  3125 NDLDMDRDGTLLLRLGHSNSFDVDATAAGPGKLRAEVRDADSSLIGNGPVVEDMGQGKYRVRFNP 3189

  Fly   167 ---GK----------PASSSVPI--------------------------------------SDSD 180
               ||          |..|:.|:                                      :|.:
 Worm  3190 DQPGKYSIYLYWNELPVESAFPVRARSSAEDLPTTSRAVREPIPPPVTTTYHTREKSSGSNADDE 3254

  Fly   181 ASRVQSRGLGLTHVSLVERNEFTVDCGQAGSNM-----LLVGVLGQRGPCEEVVVRHLGRGIHRV 240
            .||:..||.||....|.|.|||.:|    ||::     :...:||.:... .|.::.||..:::.
 Worm  3255 ISRIMVRGDGLHRAVLKEHNEFIID----GSDINKEGRITATLLGSKADI-PVRIQQLGHNVYKA 3314

  Fly   241 TYRVCDPGDYILVVKWGEQHVPGSPFSLSAD 271
            ||.....|.|.|.:.|..:||.||||::|||
 Worm  3315 TYTPLTGGTYELHILWNGKHVKGSPFAVSAD 3345

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG5984NP_651548.1 Filamin 65..154 CDD:279024 17/96 (18%)
Filamin 179..266 CDD:279024 29/91 (32%)
IG_FLMN 181..271 CDD:214720 32/94 (34%)
fln-2NP_001359882.1 SAC6 11..>242 CDD:227401
CH 235..327 CDD:381763
IG_FLMN 584..672 CDD:214720
IG_FLMN 679..762 CDD:214720
IG_FLMN 762..854 CDD:214720
IG_FLMN 866..944 CDD:214720
IG_FLMN 959..1044 CDD:214720
IG_FLMN 1051..1135 CDD:214720
PTZ00121 <1506..1928 CDD:173412
IG_FLMN 1921..2014 CDD:214720
IG_FLMN 2078..2167 CDD:214720
IG_FLMN 2167..2250 CDD:214720
IG_FLMN 2264..2347 CDD:214720
IG_FLMN 2357..2436 CDD:214720
Filamin 2501..2565 CDD:366210
Filamin 2589..2652 CDD:391771
IG_FLMN 2674..2755 CDD:214720
IG_FLMN 2755..2843 CDD:214720
IG_FLMN 2847..2936 CDD:214720