Sequence 1: | NP_651548.1 | Gene: | CG5984 / 43281 | FlyBaseID: | FBgn0039500 | Length: | 271 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_031754944.1 | Gene: | flnc / 100329116 | XenbaseID: | XB-GENE-493579 | Length: | 2767 | Species: | Xenopus tropicalis |
Alignment Length: | 337 | Identity: | 91/337 - (27%) |
---|---|---|---|
Similarity: | 139/337 - (41%) | Gaps: | 118/337 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 49 DAYPSESPRVY-VAPELTDAGKVQLLHFPSGAVRVNSPLGFIIKRNGVKGNFEVRVEGPSGQPIQ 112
Fly 113 PVRQQQLDPERFQIDCQLDAGAGLYKVHIKCNSVTLPRSPF------------------------ 153
Fly 154 ------------------------------------------------------IIVAIA-GATE 163
Fly 164 SIDGKP-----------------------------ASSSV-------PISDSDASRVQSRGLGLT 192
Fly 193 HVSLVERNEFTVDCGQAGSNMLLVGVLGQRGPCEEVVVRHLGRGIHRVTYRVCDPGDYILVVKWG 257
Fly 258 EQHVPGSPFSLS 269 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5984 | NP_651548.1 | Filamin | 65..154 | CDD:279024 | 22/166 (13%) |
Filamin | 179..266 | CDD:279024 | 52/86 (60%) | ||
IG_FLMN | 181..271 | CDD:214720 | 52/89 (58%) | ||
flnc | XP_031754944.1 | CH_FLNC_rpt1 | 22..146 | CDD:409159 | |
CH_FLNC_rpt2 | 150..264 | CDD:409163 | |||
IG_FLMN | 275..371 | CDD:214720 | |||
IG_FLMN | 375..471 | CDD:214720 | |||
IG_FLMN | 518..611 | CDD:214720 | |||
IG_FLMN | 616..705 | CDD:214720 | |||
IG_FLMN | 711..805 | CDD:214720 | |||
IG_FLMN | 808..908 | CDD:214720 | |||
IG_FLMN | 911..1007 | CDD:214720 | |||
IG_FLMN | 1011..1103 | CDD:214720 | |||
IG_FLMN | 1107..1195 | CDD:214720 | |||
IG_FLMN | 1199..1291 | CDD:214720 | |||
IG_FLMN | 1295..1391 | CDD:214720 | |||
IG_FLMN | 1394..1483 | CDD:214720 | |||
IG_FLMN | 1487..1580 | CDD:214720 | |||
IG_FLMN | 1583..1677 | CDD:214720 | |||
IG_FLMN | 1680..1776 | CDD:214720 | |||
IG_FLMN | <1834..1898 | CDD:214720 | |||
IG_FLMN | 1905..1991 | CDD:214720 | |||
IG_FLMN | 2084..2173 | CDD:214720 | |||
IG_FLMN | 2264..2350 | CDD:214720 | |||
IG_FLMN | 2356..2444 | CDD:214720 | 4/12 (33%) | ||
IG_FLMN | 2450..2540 | CDD:214720 | 21/91 (23%) | ||
IG_FLMN | 2547..2636 | CDD:214720 | 5/88 (6%) | ||
IG_FLMN | 2677..2766 | CDD:214720 | 52/89 (58%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |