DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17991 and AT1G11020

DIOPT Version :9

Sequence 1:NP_651547.1 Gene:CG17991 / 43279 FlyBaseID:FBgn0039498 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_563883.1 Gene:AT1G11020 / 837644 AraportID:AT1G11020 Length:321 Species:Arabidopsis thaliana


Alignment Length:142 Identity:36/142 - (25%)
Similarity:62/142 - (43%) Gaps:29/142 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SNVAAPQASA--GGDSTELER------------CCWICFETDKEAGRQAWVNPCLCRGTNKWVHQ 53
            |:.|:|.|::  .|:|.|::.            ||.||.|.|.|......::||:|:||.::||:
plant    29 SSSASPSAASVVAGNSDEIKAEEDLENDASSAPCCRICLEDDSELLGDELISPCMCKGTQQFVHR 93

  Fly    54 SCISLWIDEKTRINNNLQAVSCPQCQTEYTIAYP-----NLWIFDRALEL--TNDLILTNLYNCL 111
            ||:..|    ..:........|..|:.::.:...     |.|.......|  ..|::|  ::..:
plant    94 SCLDHW----RSVKEGFAFSHCTTCKAQFHLRVEPFEDNNSWRRKAKFRLFVARDVLL--VFLAV 152

  Fly   112 ANVFTVV--FAY 121
            ..|..|:  |||
plant   153 QTVIAVMAGFAY 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17991NP_651547.1 RINGv 22..79 CDD:128983 18/56 (32%)
AT1G11020NP_563883.1 RING_CH-C4HC3_MARCH 63..115 CDD:319409 17/55 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 47 1.000 Domainoid score I4521
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.