DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17991 and AT2G02960

DIOPT Version :10

Sequence 1:NP_651547.1 Gene:CG17991 / 43279 FlyBaseID:FBgn0039498 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_973407.1 Gene:AT2G02960 / 814825 AraportID:AT2G02960 Length:275 Species:Arabidopsis thaliana


Alignment Length:68 Identity:14/68 - (20%)
Similarity:31/68 - (45%) Gaps:9/68 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 LQFMLRNLGIHVRDELIDDLLREASRTGSGLIDETEFLQWVARIQALKDDSNTSSSSSSSNNPAQ 98
            |||..::......::.:|     |.:..||::::..|    ....|:...|:.|.|.:.:::|..
plant    31 LQFFKKSSDRDAGEDCVD-----AGKVSSGIVEQDNF----CNTGAIDSTSSNSVSCNKTSSPTT 86

  Fly    99 AAD 101
            .|:
plant    87 CAE 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17991NP_651547.1 RING_CH-C4HC3_MARCH5 21..82 CDD:438361 9/47 (19%)
AT2G02960NP_973407.1 RINGv 43..89 CDD:128983 10/54 (19%)
DUF3675 94..>176 CDD:463576
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.