DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17991 and march5

DIOPT Version :9

Sequence 1:NP_651547.1 Gene:CG17991 / 43279 FlyBaseID:FBgn0039498 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001076296.1 Gene:march5 / 561952 ZFINID:ZDB-GENE-070424-47 Length:281 Species:Danio rerio


Alignment Length:267 Identity:108/267 - (40%)
Similarity:168/267 - (62%) Gaps:6/267 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LERCCWICFETDKEAGRQAWVNPCLCRGTNKWVHQSCISLWIDEKTRINNNLQAVSCPQCQTEYT 83
            ::|.||:||.||::.....||.||.|||:.|||||||:..|:|||.| .|:...|:||||..||.
Zfish    13 VDRSCWVCFATDEDDRTAEWVRPCRCRGSTKWVHQSCLQRWVDEKQR-GNSTARVACPQCNAEYL 76

  Fly    84 IAYPNLWIFDRALELTNDLILTNLYNCLANVFTVVFAYWSAVSFGAKTYLQITG-QEGHVHQIIQ 147
            |.:|.|......|:|.:.||........|.:. |...||:||::||.|.:|:.| :||  ..:::
Zfish    77 IVFPKLGPVVYVLDLADRLISKACPFAAAGIM-VGSIYWTAVTYGAVTVMQVVGHKEG--LDVME 138

  Fly   148 SGDLLVVLVGFPLISVVLILGRLIPWEDALLRFIRICYSLLRSLSMMCLGRKYDHQTEPYPSAPM 212
            ..|.|.:|:|.|.|.|:||||::|.|||.:||..|...:.|:.|:.:..|........|..::|:
Zfish   139 RADPLFLLIGLPTIPVMLILGKMIRWEDYVLRLWRKYSNKLQILNSIFPGIGCPVPRIPAEASPL 203

  Fly   213 TEY-SASRVVCGAILLPTISMYVGRVLYSSVDDRLQQTLLGGLTFIAIKGFLKMYLMHSQYICRM 276
            .:: ||:|::|||::.|||:..||::::|||:..||:|:|||:.|:||||..|:|....||:.:.
Zfish   204 ADHVSATRILCGALVFPTIATIVGKLMFSSVNSNLQRTILGGIAFVAIKGAFKVYFKQQQYLRQA 268

  Fly   277 KRRVLDY 283
            .|::|::
Zfish   269 HRKILNF 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17991NP_651547.1 RINGv 22..79 CDD:128983 30/56 (54%)
march5NP_001076296.1 RINGv 17..72 CDD:128983 30/55 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170588159
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3053
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D426217at33208
OrthoFinder 1 1.000 - - FOG0003968
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46283
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X270
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
87.810

Return to query results.
Submit another query.