DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17991 and Marchf5

DIOPT Version :9

Sequence 1:NP_651547.1 Gene:CG17991 / 43279 FlyBaseID:FBgn0039498 Length:294 Species:Drosophila melanogaster
Sequence 2:XP_008758589.1 Gene:Marchf5 / 294079 RGDID:1305617 Length:293 Species:Rattus norvegicus


Alignment Length:286 Identity:109/286 - (38%)
Similarity:168/286 - (58%) Gaps:17/286 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LERCCWICFETDKEAGRQAWVNPCLCRGTNKWVHQSCISLWIDEKTRINNNLQAVSCPQCQTEYT 83
            |:|.||:||.||::.....||.||.|||:.|||||:|:..|:|||.| .|:...|:||||..||.
  Rat    10 LDRSCWVCFATDEDDRTAEWVRPCRCRGSTKWVHQACLQRWVDEKQR-GNSTARVACPQCNAEYL 73

  Fly    84 IAYPNLWIFDRALELTNDLILTNLYNCLANVFTVVFAYWSAVSFGAKTYLQITGQE--------- 139
            |.:|.|......|:|.:.||........|.:. |...||:||::||.|.:|:....         
  Rat    74 IVFPKLGPVVYVLDLADRLISKACPFAAAGIM-VGSIYWTAVTYGAVTVMQVHHSTLFSDTTFDV 137

  Fly   140 ---GHVH--QIIQSGDLLVVLVGFPLISVVLILGRLIPWEDALLRFIRICYSLLRSLSMMCLGRK 199
               ||..  .:::..|.|.:|:|.|.|.|:||||::|.|||.:||..|...:.|:.|:.:..|..
  Rat   138 KVVGHKEGLDVMERADPLFLLIGLPTIPVMLILGKMIRWEDYVLRLWRKYSNKLQILNSIFPGIG 202

  Fly   200 YDHQTEPYPSAPMTEY-SASRVVCGAILLPTISMYVGRVLYSSVDDRLQQTLLGGLTFIAIKGFL 263
            ......|..:.|:.:: ||:|::|||::.|||:..||::::|||:..||:|:|||:.|:||||..
  Rat   203 CPVPRIPAEANPLADHVSATRILCGALVFPTIATIVGKLMFSSVNSNLQRTILGGIAFVAIKGAF 267

  Fly   264 KMYLMHSQYICRMKRRVLDYTKENLA 289
            |:|....||:.:..|::|:|.::..|
  Rat   268 KVYFKQQQYLRQAHRKILNYPEQEEA 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17991NP_651547.1 RINGv 22..79 CDD:128983 29/56 (52%)
Marchf5XP_008758589.1 RING_CH-C4HC3_MARCH5 12..72 CDD:319615 31/60 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346722
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3053
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D426217at33208
OrthoFinder 1 1.000 - - FOG0003968
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46283
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X270
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.810

Return to query results.
Submit another query.