DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17991 and marc-4

DIOPT Version :9

Sequence 1:NP_651547.1 Gene:CG17991 / 43279 FlyBaseID:FBgn0039498 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001348646.1 Gene:marc-4 / 171616 WormBaseID:WBGene00016903 Length:317 Species:Caenorhabditis elegans


Alignment Length:243 Identity:55/243 - (22%)
Similarity:96/243 - (39%) Gaps:59/243 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ASNVAAPQASAGGDSTELERCCWICFETDKEAGRQAWVNPCLCRGTNKWVHQSCISLWIDEKTRI 66
            :|.::...|||        ..|.|| .|.........::||.|.||..:||::|:..|::..|| 
 Worm    67 SSKLSLQSASA--------NMCRIC-HTSTSTRSNPLISPCRCSGTLLFVHKACVVRWLEMSTR- 121

  Fly    67 NNNLQAVSCPQCQT---EY---------TIAYPNLWIFDRALELTNDL-ILTNLYNCLANVFTV- 117
                :.|..|:|:.   :|         ::..|::   ||:..|.|.| ::|.|.......||: 
 Worm   122 ----KMVPSPRCELCGYDYRRGNIFQMKSLHVPHV---DRSSCLLNVLFLITVLIMIFCGYFTIQ 179

  Fly   118 -----------VFAYWS---AVSFGAKTYLQITG-------QEGHVHQIIQSG--DLLVVL-VGF 158
                       :||:.|   |.::..:.|....|       .:|:..:...|.  |:.||| ...
 Worm   180 FIQENALLKRRLFAHSSTNTAYTWKRRGYFSGNGNGDGDGSSDGYFSRTPVSSLFDIKVVLCASM 244

  Fly   159 PLISVVLILGRLIPWEDALLRFIRICYSLLRSLSMMCLGRKYDHQTEP 206
            .|:|.:|.|......|..:.|    |......::...:.:.||.:.:|
 Worm   245 FLVSFILALFTQYKAESTIFR----CIFRFFVINKNWMIKNYDIKNDP 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17991NP_651547.1 RINGv 22..79 CDD:128983 17/56 (30%)
marc-4NP_001348646.1 RING_CH-C4HC3_MARCH 80..133 CDD:319409 18/58 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X270
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.