DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17991 and marchf11

DIOPT Version :9

Sequence 1:NP_651547.1 Gene:CG17991 / 43279 FlyBaseID:FBgn0039498 Length:294 Species:Drosophila melanogaster
Sequence 2:XP_002933170.1 Gene:marchf11 / 100487933 XenbaseID:XB-GENE-982895 Length:287 Species:Xenopus tropicalis


Alignment Length:289 Identity:53/289 - (18%)
Similarity:95/289 - (32%) Gaps:118/289 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 APQASAGGDSTELER----------CCWICFETDKEAGRQAWVNPCLCRGTNKWVHQSCISLWID 61
            |..|..||..|:.:.          .|.|||:..::.   ..:|||.|.|:.::.||.|:..||.
 Frog    28 AGAAIHGGTRTDSDSVQSNDTPSPPTCKICFQGPEQG---ELLNPCRCDGSVRYTHQLCLLKWIS 89

  Fly    62 EKTRINNNLQAVSCPQCQTEYTIAYPNLWIFDRALELTNDLILTNLYNCLANVFTVVFAYWSAVS 126
            |:       .:.:|..|...|.:.         |:.:...                  ..|..::
 Frog    90 ER-------GSWTCELCCYRYQVI---------AIRMKRP------------------CQWQCIT 120

  Fly   127 FGAKTYLQITGQEGHVHQIIQSGDLLVVLVG--FPLISVVLILGRLIP----WEDALLRFIRICY 185
                    :|        :::...::.|::|  |.:.||..:|.....    |:...:.| :|||
 Frog   121 --------VT--------LVEKVQMIAVILGSLFLISSVTWLLWSAFSPQAVWQRKDILF-QICY 168

  Fly   186 SLLRSLSMMCLG-------------------------RKYDHQTE------PYPSA------PMT 213
            .:...:.::|:|                         ..||..|:      ..||.      |:|
 Frog   169 GMYGFMDLVCIGLIVHEGAAVYTVFKRWRAVNLDWDVLNYDKATDIEESSNAVPSTSRTLWLPLT 233

  Fly   214 EY-----------SASRVVCGAILLPTIS 231
            .:           |:.|:.||.:||...|
 Frog   234 AFRSRTLVHPTQLSSPRLQCGYVLLHLFS 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17991NP_651547.1 RINGv 22..79 CDD:128983 16/56 (29%)
marchf11XP_002933170.1 RING_Ubox 54..103 CDD:388418 17/58 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.