DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31064 and si:ch211-11n16.2

DIOPT Version :9

Sequence 1:NP_001287560.1 Gene:CG31064 / 43277 FlyBaseID:FBgn0051064 Length:877 Species:Drosophila melanogaster
Sequence 2:XP_691596.6 Gene:si:ch211-11n16.2 / 563140 ZFINID:ZDB-GENE-041008-77 Length:654 Species:Danio rerio


Alignment Length:105 Identity:39/105 - (37%)
Similarity:58/105 - (55%) Gaps:15/105 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   784 DQERRQRQLLSGSAQSLQAMPE-------AVG-------SPGIWAPDSIATHCTACEREFNLTRR 834
            |.:...:::|.|....:|::.|       ||.       :|..|.|::..:.|..|:|.|....|
Zfish   431 DHQNAAQRVLDGMNYIIQSVTEYSSGPTKAVAAWLTDQVAPPYWKPNAEISECHGCKRVFEEVER 495

  Fly   835 KHHCRSCGEIFCKACSEHTLPLLNAQGQPGKPVRVCDNCY 874
            |||||:||:.||:|||.|::| :..:|..|.||||||.||
Zfish   496 KHHCRACGQGFCQACSTHSMP-VPERGWGGTPVRVCDACY 534

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31064NP_001287560.1 RUN 316..439 CDD:280855
CASP_C 495..>634 CDD:285395
FYVE_RUFY1_like 813..874 CDD:277261 29/60 (48%)
si:ch211-11n16.2XP_691596.6 P-loop_NTPase 56..289 CDD:304359
FYVE 472..536 CDD:279674 31/64 (48%)
FYVE_ZFYV1 588..648 CDD:277273
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170584045
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.