DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31064 and Rundc3a

DIOPT Version :9

Sequence 1:NP_001287560.1 Gene:CG31064 / 43277 FlyBaseID:FBgn0051064 Length:877 Species:Drosophila melanogaster
Sequence 2:XP_006533751.1 Gene:Rundc3a / 51799 MGIID:1858752 Length:465 Species:Mus musculus


Alignment Length:404 Identity:103/404 - (25%)
Similarity:164/404 - (40%) Gaps:114/404 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   280 IERSNLVNICKLVVKELLEQSLRY-GRMLDSDHLPLQHFFIVIEHVLGHGLRPKKGL-------- 335
            :||.||:.:|:..||.|||   :| ...:|.......:|..::|.:|.|..   ||:        
Mouse    26 VERRNLITVCRFSVKTLLE---KYTAEPIDDSSEEFVNFAAILEQILSHRF---KGIAESPPCPG 84

  Fly   336 -----LGP--------RKELWDLLQ----SVEHYCPEAQDITASVRDLPTVRTHIGRARAWLRIA 383
                 .||        ::..||.::    .|.:.|      .:|:.::..:.|...:.|||:|:|
Mouse    85 SACAPAGPASWFSSDGQRGFWDYIRLACSKVPNNC------VSSIENMENISTARAKGRAWIRVA 143

  Fly   384 LMQKKLSDYL-QALIEHREDSLFDYYEPHALMMSDEIVVIMGILVGLNVIDCNLCVKEEDLDSQQ 447
            ||:|::|:|: .||.::|....|  |:..|:|:.:|..|:.|:|:||:.||.:.|:|.|.||.:.
Mouse   144 LMEKRMSEYITTALRDNRTTRRF--YDSGAIMLREEATVLTGMLIGLSAIDFSFCLKGEVLDGKT 206

  Fly   448 G-VIDFSLYLR-----------------SSSRNADAAPEDSAPPALLDATGQGN--------MIA 486
            . |||::.||:                 .||.:.|.:||....|.:.|.....|        ...
Mouse   207 PVVIDYTPYLKFTQSYDYLTDEEERHSAESSTSEDNSPEHPYLPLVTDEDSWYNKWHKMEQKFRI 271

  Fly   487 VLDQKNYIEELNR-------HLNATVGNLQAKVESLTTTNALMKEDLAIARNSLLALQAE----N 540
            |..||.|:|||.|       .|.|....||.::|.....|...|.:|   ...:|.||.:    .
Mouse   272 VYAQKGYLEELVRLRESQLKDLEAENRRLQLQLEEAAAQNQREKREL---EGVILELQEQLPDPP 333

  Fly   541 QAMRQSTSAGDNNSTGSGGSSDKDKEKASEELV---------------EERRKNSELEKE----- 585
            ...|.....||:.....|          |:||.               .|...||:|.:.     
Mouse   334 PPPRTGLIPGDHAPLAQG----------SKELTTSLVNQWPSLSTLHRPEGASNSKLYRRHSFMS 388

  Fly   586 ---LKLQVSLKAES 596
               |..:.||.::|
Mouse   389 TEPLSAEASLSSDS 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31064NP_001287560.1 RUN 316..439 CDD:280855 40/148 (27%)
CASP_C 495..>634 CDD:285395 30/136 (22%)
FYVE_RUFY1_like 813..874 CDD:277261
Rundc3aXP_006533751.1 RUN 60..197 CDD:367169 39/147 (27%)
UPF0242 <266..>329 CDD:369080 19/65 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839952
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4381
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.