DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31064 and plekhf1

DIOPT Version :9

Sequence 1:NP_001287560.1 Gene:CG31064 / 43277 FlyBaseID:FBgn0051064 Length:877 Species:Drosophila melanogaster
Sequence 2:NP_956634.1 Gene:plekhf1 / 393311 ZFINID:ZDB-GENE-040426-1289 Length:293 Species:Danio rerio


Alignment Length:223 Identity:57/223 - (25%)
Similarity:95/223 - (42%) Gaps:22/223 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   657 EDMASTIDQLEKKWSHDKS--NLGEILKTTSQTLTTQVTASEERAARAEAESRIEREWRISLQEK 719
            |.:|.||...|:..:.:.|  ..|::|:...:.|..:  ...::..|...:.|:...:...|...
Zfish     3 EHLAFTIQNRERIQAVESSFGRTGKMLQKPGRFLVGE--GCLQKLCRRGPQPRVFYLFNDILVYG 65

  Fly   720 ELKLKEKIANLQGC--LKELSEEKERNGKLKADLDKVRTQWSEAQTTLEELGIQLSVSKLKVSEM 782
            .:.|..:..|.|..  |:|:.:|...:|...|:      ||. .:|..:...:.....:.|::.|
Zfish    66 SIMLHGRWNNKQNIIPLEEVQQEDLEDGMAMAN------QWL-IRTPRKSFYVSAESPEEKIAWM 123

  Fly   783 QDQERRQRQLLSGSAQSLQAMPEAVGSPGIWAPDSIATHCTACEREFNLTRRKHHCRSCGEIFCK 847
            ...|  |.:.|....:.|.|..........|.||..:..|..|.:.|.:..|:||||.||.|.|:
Zfish   124 GHIE--QYRTLHVKNKGLPAKKSGDDFATPWIPDVASAICMRCSKRFTVANRRHHCRRCGYIVCQ 186

  Fly   848 ACSE--HTLPLLNAQGQPGKPVRVCDNC 873
            |||:  ..||.::     .:|||||.||
Zfish   187 ACSKGRAVLPHIS-----NRPVRVCRNC 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31064NP_001287560.1 RUN 316..439 CDD:280855
CASP_C 495..>634 CDD:285395
FYVE_RUFY1_like 813..874 CDD:277261 27/63 (43%)
plekhf1NP_956634.1 PH_Phafin2-like 7..129 CDD:269927 24/132 (18%)
PH 39..128 CDD:278594 17/99 (17%)
PHD_SF 151..209 CDD:304600 25/62 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170584056
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.