DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31064 and fab1

DIOPT Version :9

Sequence 1:NP_001287560.1 Gene:CG31064 / 43277 FlyBaseID:FBgn0051064 Length:877 Species:Drosophila melanogaster
Sequence 2:NP_611269.1 Gene:fab1 / 37033 FlyBaseID:FBgn0028741 Length:1809 Species:Drosophila melanogaster


Alignment Length:287 Identity:59/287 - (20%)
Similarity:106/287 - (36%) Gaps:79/287 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   601 KLLE--KDIHEKQDTIVSLRRQLDDIKQINLEMYRKLQD-----CKASLTHKTELMTKLEVQKED 658
            ||.|  ::..:|.:::..  |.::.|:.:..:.|..:.|     ..:|.|...:::.|.:...:.
  Fly    20 KLTEFARNFEDKPESLFG--RVVNKIQNVYNQSYNTVNDISSGSSSSSSTQPVQVVGKSQFFSDS 82

  Fly   659 MASTIDQLEKKWSHDKSNLGE-----ILKTTSQTLTTQVTASEERAARAEAESRIEREWRISLQE 718
            ..||.:..:.:.|...|...:     .::|.|:|..|. |:|...|..:|...|:|   .:.|..
  Fly    83 QTSTAEIADVETSSQSSVRPQPPTTLSIRTNSETRGTS-TSSNTAAEDSETSDRVE---TLPLPT 143

  Fly   719 KELKLKEKIANLQGCLKELSEEKERNGKLKADLDKVRTQWSEAQTTLEELGIQLSVSKLKVSEMQ 783
            .|......::|:...:..:...|..|                            .:...|.:|:|
  Fly   144 SEANQGRTVSNVLKHISNIVATKNNN----------------------------DLRNYKDTELQ 180

  Fly   784 DQERRQRQLLSGSAQSLQAMPEAVGSPGIWAPDSIATHCTACEREFNLTRRKHHCRSCGEIFCKA 848
                                       ..|.|||.|..|..|.::|:..|||||||.||:|||..
  Fly   181 ---------------------------RFWMPDSKAKECYDCSQKFSTFRRKHHCRLCGQIFCSK 218

  Fly   849 CSEHTLP--LLNAQGQPGKPVRVCDNC 873
            |....:|  ::...|.    ::||:.|
  Fly   219 CCNQVVPGMIIRCDGD----LKVCNYC 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31064NP_001287560.1 RUN 316..439 CDD:280855
CASP_C 495..>634 CDD:285395 7/34 (21%)
FYVE_RUFY1_like 813..874 CDD:277261 26/63 (41%)
fab1NP_611269.1 FYVE_PIKfyve_Fab1 182..243 CDD:277264 26/64 (41%)
DEP 329..397 CDD:214489
Fab1_TCP 464..717 CDD:239450
PIPKc 1413..1797 CDD:295374
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2108
SonicParanoid 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.