DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31064 and Plekhm2

DIOPT Version :9

Sequence 1:NP_001287560.1 Gene:CG31064 / 43277 FlyBaseID:FBgn0051064 Length:877 Species:Drosophila melanogaster
Sequence 2:NP_001178696.1 Gene:Plekhm2 / 313667 RGDID:1307005 Length:1031 Species:Rattus norvegicus


Alignment Length:468 Identity:95/468 - (20%)
Similarity:171/468 - (36%) Gaps:133/468 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   279 EIERSNLVNICKLVVKELLEQSLRYGRMLDSDHLP--------LQHFFIVIEHVLGHGLRPKKGL 335
            |::...|.|| .|.||:|  ||  |....: |..|        ||.....::|.|.:||:     
  Rat     5 EVKDRILENI-SLSVKKL--QS--YFAACE-DETPAIRNHDKVLQRLCEHLDHALLYGLQ----- 58

  Fly   336 LGPRKELWDLLQS----VEHYCPEAQDITASVRDLPTVRTHIGRARAWLRIALMQKKLSDYLQAL 396
                    ||...    |.|:  ..::....:..|..|.|::||:||||.:||.:..|..||: |
  Rat    59 --------DLSSGYWVVVVHF--TRREAIRQIEVLQHVATNLGRSRAWLYLALNENSLESYLR-L 112

  Fly   397 IEHREDSLFDYYEPHALMMS-DEIVVIMGILVGLNVIDCNLCVKEEDLDS--------------Q 446
            .:.....|..||..:||:.| |.:.:.:.::.||..|..:|     |||:              .
  Rat   113 FQENLGLLQKYYVRNALVCSHDHLTLFLTLVSGLEFIRFDL-----DLDAPYLDLAPYMPDYYKP 172

  Fly   447 QGVIDFSLYLRSSSRNADAAP--------------EDSAPPALLDATGQGNMIAVLDQKNYIEEL 497
            |.::||...|.||...:|:..              :|||.....:....|::...:......:..
  Rat   173 QYLLDFEDRLPSSVHGSDSLSLNSFNSVTSTNLEWDDSAIAPSSEDYDFGDVFPAVPSVPSTDWE 237

  Fly   498 NRHLNATVGNLQAKVESLTTTNALMKEDLAIARNSLLALQAENQAMRQSTSAGDNNSTGSGGSSD 562
            :..|..|:...::....||::.|..|.          ..|..|....:...:..:.:|....:| 
  Rat   238 DGDLTDTISGPRSTASDLTSSKASTKS----------PTQRHNPFNEEQAESASSETTPVHTTS- 291

  Fly   563 KDKEKASEELVEERRKNSELE-----KELKLQVSLKAESDMAMKLLEKDIHEKQ----------- 611
              :||...:..::....:|||     |:.|:....|.:.|.....|..:..:::           
  Rat   292 --QEKEEAQAPDQPDACTELEVIRVTKKKKIGKKKKTKLDEEASPLHPNCSQQKCGRQGDGDGLV 354

  Fly   612 ----------DTIVSLRRQL-------------DDIKQINLEMYRKLQDCKASLTHKTELMTKLE 653
                      |||::..::.             .::.|:.| :..:::|            |.:|
  Rat   355 GTPGLARNCSDTILASPQEQGEGPGSTAGSCEHSELSQMGL-LIPEMKD------------TSME 406

  Fly   654 VQKEDMASTIDQL 666
            ...:.::..||||
  Rat   407 CLGQPLSKVIDQL 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31064NP_001287560.1 RUN 316..439 CDD:280855 34/127 (27%)
CASP_C 495..>634 CDD:285395 25/177 (14%)
FYVE_RUFY1_like 813..874 CDD:277261
Plekhm2NP_001178696.1 RUN 93..156 CDD:214736 22/68 (32%)
PH 784..885 CDD:278594
PH_SKIP 785..887 CDD:270119
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343796
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4381
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.