DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31064 and Plekhf1

DIOPT Version :9

Sequence 1:NP_001287560.1 Gene:CG31064 / 43277 FlyBaseID:FBgn0051064 Length:877 Species:Drosophila melanogaster
Sequence 2:NP_001013166.1 Gene:Plekhf1 / 308543 RGDID:1310544 Length:279 Species:Rattus norvegicus


Alignment Length:111 Identity:38/111 - (34%)
Similarity:50/111 - (45%) Gaps:23/111 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   774 VSKLKVSEMQD-----QERRQRQLLSGSAQ--SLQAMPEAVGSPGIWAPDSIATHCTAC-EREFN 830
            ||....:|.|:     :|..:||||:...|  :..|.|        |.||.....|..| :..|:
  Rat   111 VSAASTTERQEWISHIEECVRRQLLATGRQPTTEHAAP--------WIPDKATDICMRCTQTRFS 167

  Fly   831 LTRRKHHCRSCGEIFCKACSEH--TLPLLNAQGQPGKPVRVCDNCY 874
            ...|:||||.||.:.|..||..  .||.|:.     ||:|||..||
  Rat   168 ALTRRHHCRKCGFVVCAECSRERFLLPRLSP-----KPLRVCSLCY 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31064NP_001287560.1 RUN 316..439 CDD:280855
CASP_C 495..>634 CDD:285395
FYVE_RUFY1_like 813..874 CDD:277261 24/63 (38%)
Plekhf1NP_001013166.1 PH_Phafin2-like 7..129 CDD:269927 4/17 (24%)
PH 39..131 CDD:278594 5/19 (26%)
FYVE_PKHF1 148..211 CDD:277293 27/74 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 219..264
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343797
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.